Dataset for protein BCL-2-like of organism Gopherus evgoodei

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8C4VT25_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Gopherus evgoodei GN=BCL-2 (length=233 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAANENRGPVSPNLSPPTATGTSSDHAGLMSLPPEPPGSAAASNVPLGDGL
RPAPQAVLLALCQAGDEFSRRYHRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDSIAVWMTEYLNRHLHNWIQDNGGWDAFVELYGRNMRPVFDFSWISLKTILSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C4W4P8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Gopherus evgoodei GN=BCL2A1 (length=170 residues).
MESSEYCYVYYLVQDYLKYVLQEPQLGPAPSRVAHVLRHAASFLQKENEESLKPCLDTFDITSVDAARRIFTQVMDKEFA
DGNTNWGRILTIFMFGGILSKKLQEHRVQLTGENKKQISYFITEYIINTKAEWIEANGGWVSFSAVFYNHFSLLSRSEEF
SLINFFKMFF
>gnl|bcl2dbpro|A0A8C4W8N7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Gopherus evgoodei GN=BCL2L1 (length=290 residues).
MKFTRAKPSQHTVLNWSSSGEDIRTSPSLFAFRSWSDRGGELRFPRPELSPSSYSRGLSAQGSDVCLDSRGEQSLDLLSQ
RGYSWSRFEGEDEIRTDSAEEAEMASVPNGSPSWHQGASHIVNGAAGHSNSLEAHERVPATGVRQALREAGDEFELRYRR
AFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVGRIVSWMTTYLTDHLDPWIQ
ENGGWERFVDLYGNDAAAKSRKGQEQFNRWLLTGATLAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C4YAJ9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Gopherus evgoodei GN=MCL-1 (length=317 residues).
MLALKRNAVIGLNLYCGGGPTLPPSAPASPSGAGTPPAPGPAAEGVRPATLIGGASWGSNGHSEGARALIGSPAAAPSLV
AGGPRPGPLWRPEEELDGCDPDAERMGPPGAAGGSLPSTPPAEDDDELDGLYQDSLELISRYLREAAELGGPGGKKLLKR
LLSGPRGAGPAAMEKALETLRRVGDGVIEKHQIAFQGMLRKLDIKNEDDLKSVTAVATHVFSDGVTNWGRIVTLISFGAF
VAKHLKSINQENCINTLAGIITDVLVTGKRDWLVNQRGWEGFVEFFRVEDLEGSIRNVLVAFAGFAGLGASLAYMMR
© 1998-2022Legal notice