Dataset for protein BCL-2-like of organism Gopherus evgoodei

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4W4P8_BCL2A1-      --------------------------------------------------
A0A8C4VT25_BCL2-01      -----------------------------------MAHP-----------
A0A8C4W8N7_BCL2L1-      ------------MKFTRAKPSQHTVLNWSSSGEDIRTSP----------S
A0A8C4YAJ9_MCL1-01      MLALKRNAVIGLNLYCGGGPTLPPSAPASPSGAGTPPAPGPAAEGVRPAT
                                                                          

A0A8C4W4P8_BCL2A1-      --------MESSEYCYVYYLV-----------------------------
A0A8C4VT25_BCL2-01      --GRRGYDNREIVLKYIHY-------------------------------
A0A8C4W8N7_BCL2L1-      LFAFRSWSDRGGELRFPRPELSPSSYSRGLSAQGSDVCLDSRGEQSLD--
A0A8C4YAJ9_MCL1-01      LIGGASWGSNGHSEG-ARALIGSPAAAPSLVAGGPRPGPLWRPEEELDGC
                                                                          

A0A8C4W4P8_BCL2A1-      --------------------------------------------------
A0A8C4VT25_BCL2-01      -----KLSQRGYDWAAN-----------------ENRGPVSPNLSPPTAT
A0A8C4W8N7_BCL2L1-      -----LLSQRGYSWSRF------EGEDEIRTDSAEEAEMAS------VPN
A0A8C4YAJ9_MCL1-01      DPDAERMGPPGAAGGSLPSTPPAEDDDELDGLYQDSLELISRYLREAAEL
                                                                          

A0A8C4W4P8_BCL2A1-      -----QDYLKYVLQEPQ-------------LGPAPSRVAHVLRHAASFLQ
A0A8C4VT25_BCL2-01      GTSSDHAGLMSLPPEPPGSAAASNVPLGDGLRPAPQAVLLALCQAGDEFS
A0A8C4W8N7_BCL2L1-      GSPSWHQGASHIVNGAAGHSNS----LEAHERVPATGVRQALREAGDEFE
A0A8C4YAJ9_MCL1-01      GGPGGKKLLKRLLSGPRGAGPA-----------AMEKALETLRRVGDGVI
                             :     :   .                 .   .  .*  ... . 

A0A8C4W4P8_BCL2A1-      KENEESLKPCLDTFDITSVDAARRIFTQVMDKEFADGNTNWGRILTIFMF
A0A8C4VT25_BCL2-01      RRYHRDFAQMSGQLHLTPFTARGR-FVAVVEELFRDGV-NWGRIVAFFEF
A0A8C4W8N7_BCL2L1-      LRYRRAFSDLTSQLHITPGTAYQS-FEQVVNELFRDGV-NWGRIVAFFSF
A0A8C4YAJ9_MCL1-01      EKHQIAFQGMLRKLDIKNEDDLKS-VTAVATHVFSDGVTNWGRIVTLISF
                              :      : :.        .  *    * **  *****:::: *

A0A8C4W4P8_BCL2A1-      GGILSKKLQEHRVQLTGENKKQISYFITEYIINTKAEWIEANGGWVSFSA
A0A8C4VT25_BCL2-01      GGVMCVESVNREMSPL---VDSIAVWMTEYLNRHLHNWIQDNGGWDAFVE
A0A8C4W8N7_BCL2L1-      GGALCVESVDKEMQVL---VGRIVSWMTTYLTDHLDPWIQENGGWERFVD
A0A8C4YAJ9_MCL1-01      GAFVAKHLKSINQENC---INTLAGIITDVLVTGKRDWLVNQRGWEGFVE
                        *. :.    .   .        :   :*  :      *:  : **  *  

A0A8C4W4P8_BCL2A1-      VFY--------------NHFSLLSRSEEFSLINFFKMFF--------
A0A8C4VT25_BCL2-01      LYG--------RNMRPVFDFSWISLKTILSLALVGACITLGAYLGHK
A0A8C4W8N7_BCL2L1-      LYG-NDAAAKSRKGQEQFN-RWLLTGATLA-----GVLLLGSLLSRK
A0A8C4YAJ9_MCL1-01      FFRVEDLEGSIRNVLVAFA-GFAGLGASLA-----YMMR--------
                        .:                          ::       :         

© 1998-2022Legal notice