Dataset for protein Bcl2l10 of organism Gadus morhua

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 ***************************************************************
-----------------MSCRLWKETLALSEDYLLSCTASTGTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLAQ
mmascltcikmaissrn                                                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
CEADACAGLRKVMEELVGDGQLNWGRVVSLFTFTGVLARQLQEKKGVQLGQDPGTGRALGQVPGGSCRGLAETIADYLGE
                                                                                

       170       180       190       200       210  
....:....|....:....|....:....|....:....|....:....|..
****************************************************
EKRDWLLENGGWEGFCKFSRIAREVNQESSMKTALFAAAGVGIAGLTFLLVR
                                                    
© 1998-2022Legal notice