Dataset for protein Bcl2l10 of organism Gadus morhua

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5CY11_BCL2L10      MMASCLTCIKMAISSRNMSCRLWKETLALSEDYLLSCTASTGTAPPPPSE
D2IT42_BCL2L10-02       -----------------MSCRLWKETLALSEDYLLSCTASTGTAPPPPSE
                                         *********************************

A0A8C5CY11_BCL2L10      SAAAMRGLAQDMERQHYARFQALAQSFLAQCEADACAGLRKVMEELVGDG
D2IT42_BCL2L10-02       SAAAMRGLAQDMERQHYARFQALAQSFLAQCEADACAGLRKVMEELVGDG
                        **************************************************

A0A8C5CY11_BCL2L10      QLNWGRVVSLFTFTGVLARQLQEKKGVQLGQDPGTGRALGQVPGGSCRGL
D2IT42_BCL2L10-02       QLNWGRVVSLFTFTGVLARQLQEKKGVQLGQDPGTGRALGQVPGGSCRGL
                        **************************************************

A0A8C5CY11_BCL2L10      AETIADYLGEEKRDWLLENGGWEGFCKFSRIAREVNQESSMKTALFAAAG
D2IT42_BCL2L10-02       AETIADYLGEEKRDWLLENGGWEGFCKFSRIAREVNQESSMKTALFAAAG
                        **************************************************

A0A8C5CY11_BCL2L10      VGIAGLTFLLVR
D2IT42_BCL2L10-02       VGIAGLTFLLVR
                        ************

© 1998-2022Legal notice