Dataset for protein Bcl2l10 of organism Gadus morhua

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C5CY11_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Gadus morhua GN=BCL2L10 (length=212 residues).
MMASCLTCIKMAISSRNMSCRLWKETLALSEDYLLSCTASTGTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLAQ
CEADACAGLRKVMEELVGDGQLNWGRVVSLFTFTGVLARQLQEKKGVQLGQDPGTGRALGQVPGGSCRGLAETIADYLGE
EKRDWLLENGGWEGFCKFSRIAREVNQESSMKTALFAAAGVGIAGLTFLLVR
>gnl|bcl2dbpro|D2IT42_BCL2L10-02 BCL2-like 10 protein OS=[Eukaryota] Gadus morhua GN=BCL2L10 (length=195 residues).
MSCRLWKETLALSEDYLLSCTASTGTAPPPPSESAAAMRGLAQDMERQHYARFQALAQSFLAQCEADACAGLRKVMEELV
GDGQLNWGRVVSLFTFTGVLARQLQEKKGVQLGQDPGTGRALGQVPGGSCRGLAETIADYLGEEKRDWLLENGGWEGFCK
FSRIAREVNQESSMKTALFAAAGVGIAGLTFLLVR
© 1998-2022Legal notice