Dataset for protein Bcl-2 of organism Ficedula albicollis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAAVAAAAGTSSDHTGPVSPHPEPPGSAAASPA
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
                                                                                

       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
************************************          *. *   ::    :   .*     :: *    *
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWD----------RslFdkywivlktlwspvLvtntrtlhAyplhK
                                    afvelygnsm pc afsffsaaqilila dgaciaig slge 
© 1998-2022Legal notice