Dataset for protein Bcl-2 of organism Ficedula albicollis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A803VR88_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ficedula albicollis GN=BCL-2 (length=229 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAAVAAAAGTSSDHTGPVSPHPEPPGSAAASPA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDRSCFAKYFFVAAQLWIPALDTNTRAIHASPLEK
>gnl|bcl2dbpro|A0A803VR88_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Ficedula albicollis GN=BCL-2 (length=239 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAAVAAAAGTSSDHTGPVSPHPEPPGSAAASPA
PPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
© 1998-2022Legal notice