Dataset for protein Bcl-2 of organism Ficedula albicollis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A803VR88_BCL2-02      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAA
A0A803VR88_BCL2-01      MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEHRAPLPPGLSAPAAAA
                        **************************************************

A0A803VR88_BCL2-02      VAAAAGTSSDHTGPVSPHPEPPGSAAASPAPPAEGLRPAPQVVHLVLRQA
A0A803VR88_BCL2-01      VAAAAGTSSDHTGPVSPHPEPPGSAAASPAPPAEGLRPAPQVVHLVLRQA
                        **************************************************

A0A803VR88_BCL2-02      GDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAF
A0A803VR88_BCL2-01      GDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAF
                        **************************************************

A0A803VR88_BCL2-02      FEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWD----
A0A803VR88_BCL2-01      FEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVE
                        **********************************************    

A0A803VR88_BCL2-02      ------RSCFAKYFFVAAQLWIPALDTNTRAIHASPLEK
A0A803VR88_BCL2-01      LYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
                              *. *   ::    :   .*     :: *    *

© 1998-2022Legal notice