Dataset for protein BCL-2-like of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    *                                                           
------msqsnrelvvdflsYklsq-gy-w-----------capegtasgsgtpsssngr--apswhladppavngatah
mahagrtgydkininmkynl ----k--s-sqfsdveenrtegga-leaemega-aig-nlv-vgrtstpsrp-apgegg
 mmtpasfgltaqaliglih e r r  e dr    agdaga--p a-pap-if -qp -tp -akeapar-epg--asa
  afdllrprv g  t----   p                 -  - - --- --  --     t-------l-g-rt---
      kana  a  l  vg                                             akdrk gs s  p t
        e      a   e                                                 e  g      r
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
avsldgrgvspmaavkq---------------------------------------------------------------
ssagaapeli-vptlvhdarrvarpspigaegpdvtatppkllffaatrcasppekmegpaadaimspeeeldgyepepl
-aiagsaaa- p-p-ap                                      e                        
pele-----g - -p--                                                               
k c     e  a d l                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             .:*
-----------------------------------------------------------------------------tLR
gkrpavlpllelvgeassgpgtdgslpstpppaeeeedelfrqsleiisrylreqatgakdakplggsgaasrkallam 
                                                                            ev  
                                                                            q   
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .  .  ..      :            .    .  :   :: .    .**.:*::: *.. :                
raGDeferryr---raFsgmtsqLhitpgtavqsfsrVvvelFrdGv--NWGRiVaffsFGgalcvesvs----------
evaagvqlnherfltdyqdllrk-dlknendykrleqlmnhvlsnpqtls  hv tlie aafvakhlkngtylnltpdq
ql  dist fq   st aeys-- ---rfsrrglvat sed  qg p      l   lv   vmlerppd          
  q rq         r  -a   v     qe   eq                  t   t  a g p          
                  a                  d                                        
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        :       :   :   *      *:    **                                         
-------kemevlvsriaewmttyLnrhlrdWiqkngGWdgf------------vefygvedlpgsrr----------rv
qqeleweinqqscieplvtsiadv vdtkep lveqr  vttehqrcarlcapqgllfh-smaeegiklregswersnna
       r vspdcdnvqlllver ttrhht  hdsd  lal            ta--ppnaqalfdf    gqvlvlk-
       t  gq  qq  a  cn  eg  aa  esh   awi            l-hs-n---qwtwy    nrastsaw
              gh      a           a     v             c   seqss slts    el krr-l
                                        i                  dpl  rasl     k   htg
                                        e                   g                 de
                                                            f                   
                                                                                

       410       420       430       440       450        
....:....|....:....|....:....|....:....|....:....|....:...
                                                          
llafalvagvvtllaylir---------------------------------------
---lvgsgasglgg--f--kltgrdcwpgrwrkpplggsdhsaqlpsqgrssrrrgrc
tvsgqr-spciaf-sl-ghrgs                                    
qttalalc-----tpq dsn l                                    
frq---i-ftmnvrnf wqg                                      
 gnpmtcicllmtklc sfa                                      
 elk d   dkgmci  pa                                       
  gd      f i d  a                                        
  e                                                       
© 1998-2020Legal notice