Dataset for protein BCL-2-like of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :                                                                  
---a-rnavsnrelvvdylgyklsqkgysws----va----aaprgtvsgmetpsviggs--apswhtadppavrgatps
mfg-k-msqiglniycgfaslaagsg-a---ggsl--vnrtetaereegeggagas-n-rag-sppallasdprnv-rgh
 amlgatgydvit nmkgihh----- -esdqfrd eegke------a-------aq- ntp -----pp----apt-aa
 mhtdlsrpytaq lt---e e r r     r     gdagcggp a-pap if -sp -lv tarts-- lsp-- a--
  afpglfnr  g ar  v-   p                    a l a s ga          gakdrk gggsr pst
      k ga  a  l  t                                                  e         r
      e e      a                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pssaegpevtptppvlq---------------------------------------------------------------
sigldardliamaakvlffaatrcasppekmegpaadaimspeeeldgyepeplgkrpavlpllelvgeassgpgtdgsl
aaaga--a-s-v---khl           e                                                  
--ve-  -p-s- sr--q                                                              
kvl q  qeg h dp s                                                               
 ec    g   a                                                                    
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                   .:.  .  .                    
---------------------------------------------------tLRragdgfqrryr---rafsgmlsqlhi
pstpppaeeeedelfrqsleiisrylreqatgakdakplggsgaasrkaleamqevafevelnherfltdyqdltrk-dl
                                                   v  ql adistevq   stlaeys--f-v
                                                        s rq f    kk rpc-d   -
                                                        q  g         k  aa    
                                                                              
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .    .  :    : .    .**.:*::: * . :                                  :   :  
tp-gtavqsfsrVvvelFrdGv--NWGRiVaffsFggflcvesvs-----------------kemeslve--piaewmtd
knvendykrleqlmnhvlsnpqtls  hv tlie eaavakhlkngtylnltpdqqqeleweinqqpcisafrlvtsiat
-s fsrrglvat seke qg pi     l  ilv a vmlerppd                 rrvsvdcd  nvsllvve
vr d  qti  eqd  e  i           t   t iakglq                 t ivq aq  q qaflcn
       e    d                  a   i      p                 e  g   g  k  y   a
                                                                        h       
                                                                                
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :      *:    **                                                                
yLnrhlrdWiqkngGW-dgf------------vefygvedlpgsrr----------r-ll-falvagvvtllayl-r---
vivdtkep lveqr  gvttehqrcarlcapqg-lfh-smaeegiklregswersnnv--a-lg-ga-ilgg---i-kly
r ttrtht  rdsd   lel            -l--ppnaqalfdf    gqvlvl-atvtl--s--sga--llfghnyt
f ek hge  hsh    kai            tass-n---qwtwy    nrastskwqtsgvrlspc--fvss dsrgs
   g  aa  eq     ewg            pthlveqsslsltw    el krralfrqaqaicftmnvtpq wqg l
           a     ava            l   srple rass     k   hvg gnpmtctcllmtrnf ska  
                  n             c   clkh  k gq          te elk e i kkgmkic pf   
                  i                  dgf  c el          d   gd d   dfckcd  la   
                                      f                     e         i    a    
                                      a                                         

       410       420       430      
....:....|....:....|....:....|....:.
                                    
------------------------------------
grdcwpgrwrkpplggsdhsaqlpsqgrssrrrgrc
                                    
                                    
                                    
                                    
                                    
                                    
                                    
                                    
© 1998-2022Legal notice