Dataset for protein BCL-2-like of organism Felis catus

[Download (right click)] [Alignment] [Repertoires]

13 sequence(s)

>gnl|bcl2dbpro|A0A2I2UAE3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Felis catus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A337RYG8_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Felis catus GN=BCL2L10 (length=192 residues).
MADALRERTAQLLTDYLEYCAREPGSPARTPSTPEAAVLRYLAAQIRQRHQRFLSAYRGYRGNRVELVARLEQDLLSNPQ
TLSWGHVVALLTFAGTLLERPPPGTYLNLTPDQQQELEWETNVGQDCQHLVALLCNRLTGRHRAWLEAHDGWDGFCLFFS
PMLPSSWRRLLVQALLSCFTVMILIYFWRRLL
>gnl|bcl2dbpro|A0A337S3J9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Felis catus GN=MCL-1 (length=330 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSL
PSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGDKA
>gnl|bcl2dbpro|A0A337S3J9_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Felis catus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSL
PSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A337S3J9_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Felis catus GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNENDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|M3X1R9_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Felis catus GN=BCL-2 (length=224 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAA
GPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
NREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWLILLPRTSYELKSSRALREDVRISPSFLFKD
>gnl|bcl2dbpro|M3X1R9_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Felis catus GN=BCL-2 (length=237 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAA
GPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESV
NREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|M3XA94_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Felis catus GN=BCL2L1 (length=224 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWVWTGLFYPEFLAQGLRLGKGLASICSMNMRLLLDAG
>gnl|bcl2dbpro|M3XA94_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Felis catus GN=BCL2L1 (length=247 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWVVIEHQRCARLCAPQGAHSPEQSSPWSTSSRERRHDGQGNKQDCSGDKLFCN
QLPQNLS
>gnl|bcl2dbpro|M3XA94_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Felis catus GN=BCL2L1 (length=271 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQVRTNAETELPQRVCPVLGTTPCLDFAGTGRDCW
PGRWRKPPLGGSDHSAQLPSQGRSSRRRGRC
>gnl|bcl2dbpro|Q7YRZ9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Felis catus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDARRVARPS
PIGAEGPDVTATPPKLLFFAATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSL
PSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
NDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|Q8I008_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Felis catus GN=BCL-2 (length=235 residues).
MAHAGRTGYDNREIVMKYIHYELPQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAGP
ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVEGVNR
EMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|Q8SQ42_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Felis catus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2020Legal notice