Dataset for protein BCL-2-like of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337S3J9_MCL1-03      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
Q7YRZ9_MCL1-01          MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
A0A337S3J9_MCL1-02      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
A0A337S3J9_MCL1-01      MFGLKRNAVIGLNLYCGGAGLAAGSGGASSSGGRLVAVGKEATARREVGG
M3WHW2_BCL2A1-01        --MADGEFGYVLTLARDYTEH-----------------------------
A0A2I2UAE3_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
A0A5F5Y6Y3_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDAGAAPPGAAPA
A0A5F5Y6Y3_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDAGAAPPGAAPA
Q8I008_BCL2-01          MAHAGRTGYDNREIVMKYIHYELPQRGYEWD-----AGDAGAAPPGAAPA
A0A5F5XYW0_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A5F5XYW0_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A5F5XYW0_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
Q8SQ42_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESE
A0A337RYG8_BCL2L10      --MADALRERTAQLLTDYLEY--------------------CA-------
A0A337S3J9_MCL1-04      --MFGLKRNAVIGLNL----Y--------------------CGGAGLAAG
                                     :                                    

A0A337S3J9_MCL1-03      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
Q7YRZ9_MCL1-01          GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
A0A337S3J9_MCL1-02      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
A0A337S3J9_MCL1-01      GEAGAVIGGSAGASPPATLAPDARRVARPSPIGAEGPDVTATPPKLLFFA
M3WHW2_BCL2A1-01        --------------------------------VLQGPQPGSHPSRVSQ--
A0A2I2UAE3_BCL2L2-      -------------------------------VCGAGPGEGPAADPLHQ--
A0A5F5Y6Y3_BCL2-02      PGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAAGPALSPVPPVVHL--
A0A5F5Y6Y3_BCL2-01      PGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAAGPALSPVPPVVHL--
Q8I008_BCL2-01          PGIFSSQPGRTPAPARTSPPPPPVAP--AAAAAAAGPALSPVPPVVHL--
A0A5F5XYW0_BCL2L1-      METPSAINGN---PSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ---
A0A5F5XYW0_BCL2L1-      METPSAINGN---PSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ---
A0A5F5XYW0_BCL2L1-      METPSAINGN---PSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ---
Q8SQ42_BCL2L1-01        METPSAINGN---PSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ---
A0A337RYG8_BCL2L10      ------------------REPGSPARTPSTPEAA----------------
A0A337S3J9_MCL1-04      SGGASSSGGRLVATGAKDAKPLGGSGAASRKALE----------------
                                                                          

A0A337S3J9_MCL1-03      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
Q7YRZ9_MCL1-01          ATRCASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A337S3J9_MCL1-02      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
A0A337S3J9_MCL1-01      ATRCASPPEKMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
M3WHW2_BCL2A1-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A5F5Y6Y3_BCL2-02      --------------------------------------------------
A0A5F5Y6Y3_BCL2-01      --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A5F5XYW0_BCL2L1-      --------------------------------------------------
A0A5F5XYW0_BCL2L1-      --------------------------------------------------
A0A5F5XYW0_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
                                                                          

A0A337S3J9_MCL1-03      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
Q7YRZ9_MCL1-01          SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
A0A337S3J9_MCL1-02      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
A0A337S3J9_MCL1-01      SSGPGTDGSLPSTPPPAEEEEDELFRQSLEIISRYLREQATGAKDAKPLG
M3WHW2_BCL2A1-01        --------------------------------------------------
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
A0A5F5Y6Y3_BCL2-02      --------------------------------------------------
A0A5F5Y6Y3_BCL2-01      --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
A0A5F5XYW0_BCL2L1-      --------------------------------------------------
A0A5F5XYW0_BCL2L1-      --------------------------------------------------
A0A5F5XYW0_BCL2L1-      --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
                                                                          

A0A337S3J9_MCL1-03      GSGAASRKALETLRRVGDGVQRNHE---TAFQGMLRKLDIKN-ENDVKSL
Q7YRZ9_MCL1-01          GSGAASRKALETLRRVGDGVQRNHE---TAFQGMLRKLDIKN-ENDVKSL
A0A337S3J9_MCL1-02      GSGAASRKALETLRRVGDGVQRNHE---TAFQGMLRKLDIKN-ENDVKSL
A0A337S3J9_MCL1-01      GSGAASRKALETLRRVGDGVQRNHE---TAFQGMLRKLDIKN-ENDVKSL
M3WHW2_BCL2A1-01        -----------VLQDVAFSVQGEVE---KKLKPCLDKFHVVSVDTARTIF
A0A2I2UAE3_BCL2L2-      -----------AMRAAGDEFETRFR---RTFSDLAAQLHVTP-GSAQQRF
A0A5F5Y6Y3_BCL2-02      -----------TLRQAGDDFSRRYR---RDFAEMSSQLHLTP-FTARGRF
A0A5F5Y6Y3_BCL2-01      -----------TLRQAGDDFSRRYR---RDFAEMSSQLHLTP-FTARGRF
Q8I008_BCL2-01          -----------TLRQAGDDFSRRYR---RDFAEMSSQLHLTP-FTARGRF
A0A5F5XYW0_BCL2L1-      -----------ALREAGDEFELRYR---RAFSDLTSQLHITP-GTAYQSF
A0A5F5XYW0_BCL2L1-      -----------ALREAGDEFELRYR---RAFSDLTSQLHITP-GTAYQSF
A0A5F5XYW0_BCL2L1-      -----------ALREAGDEFELRYR---RAFSDLTSQLHITP-GTAYQSF
Q8SQ42_BCL2L1-01        -----------ALREAGDEFELRYR---RAFSDLTSQLHITP-GTAYQSF
A0A337RYG8_BCL2L10      -----------VLRYLAAQIRQRHQRFLSAYRGY-------R-GNRVELV
A0A337S3J9_MCL1-04      -----------TLRRVGDGVQRNHE---TAFQGMLRKLDIKN-ENDVKSL
                                   .:.  .  .                        .    .

A0A337S3J9_MCL1-03      SRVMVHVFSDGVT-NWGRIVTLISFGAFVAKHLKS---------------
Q7YRZ9_MCL1-01          SRVMVHVFSDGVT-NWGRIVTLISFGAFVAKHLKS---------------
A0A337S3J9_MCL1-02      SRVMVHVFSDGVT-NWGRIVTLISFGAFVAKHLKS---------------
A0A337S3J9_MCL1-01      SRVMVHVFSDGVT-NWGRIVTLISFGAFVAKHLKS---------------
M3WHW2_BCL2A1-01        HQVMEKEFEDGII-NWGRIVTIFAFEGILIKKLLQ---------------
A0A2I2UAE3_BCL2L2-      TQVSDELFQGGP--NWGRLVAFFVFGAALCAESVN---------------
A0A5F5Y6Y3_BCL2-02      ATVVEELFRDGV--NWGRIVAFFEFGGVMCVESVN---------------
A0A5F5Y6Y3_BCL2-01      ATVVEELFRDGV--NWGRIVAFFEFGGVMCVESVN---------------
Q8I008_BCL2-01          ATVVEELFRDGV--NWGRIVAFFEFGGVMCVEGVN---------------
A0A5F5XYW0_BCL2L1-      EQVVNELFRDGV--NWGRIVAFFSFGGALCVESVD---------------
A0A5F5XYW0_BCL2L1-      EQVVNELFRDGV--NWGRIVAFFSFGGALCVESVD---------------
A0A5F5XYW0_BCL2L1-      EQVVNELFRDGV--NWGRIVAFFSFGGALCVESVD---------------
Q8SQ42_BCL2L1-01        EQVVNELFRDGV--NWGRIVAFFSFGGALCVESVD---------------
A0A337RYG8_BCL2L10      ARLEQDLLSNPQTLSWGHVVALLTFAGTLLERPPPGTYLNLTPDQQQELE
A0A337S3J9_MCL1-04      SRVMVHVFSDGVT-NWGRIVTLISFGAFVAKHLKS---------------
                          :    : .    .**.:*::: * . :                     

A0A337S3J9_MCL1-03      --INQESCIE--PLAESITDVLVRTKRDWLVKQRGW-DGF----------
Q7YRZ9_MCL1-01          --INQESCIE--PLAESITDVLVRTKRDWLVKQRGW-DGF----------
A0A337S3J9_MCL1-02      --INQESCIE--PLAESITDVLVRTKRDWLVKQRGWGKEA----------
A0A337S3J9_MCL1-01      --INQESCIE--PLAESITDVLVRTKRDWLVKQRGW-DGF----------
M3WHW2_BCL2A1-01        --ERIVPDADAFKVSYFVAEFITKHTGEWIRQNGGW-ENG----------
A0A2I2UAE3_BCL2L2-      --KEMEPLVG--QVQEWMVAYLETRLADWIHSSGGW-AEF----------
A0A5F5Y6Y3_BCL2-02      --REMSPLVD--NIALWMTEYLNRHLHTWIQDNGGW-LIL----------
A0A5F5Y6Y3_BCL2-01      --REMSPLVD--NIALWMTEYLNRHLHTWIQDNGGW-DAF----------
Q8I008_BCL2-01          --REMSPLVD--NIALWMTEYLNRHLHTWIQDNGGW-DAF----------
A0A5F5XYW0_BCL2L1-      --KEMQVLVS--RIATWMATYLNDHLEPWIQENGGW-DTF----------
A0A5F5XYW0_BCL2L1-      --KEMQVLVS--RIATWMATYLNDHLEPWIQENGGW-VVIEHQRCARLCA
A0A5F5XYW0_BCL2L1-      --KEMQVLVS--RIATWMATYLNDHLEPWIQENGGW-VWT----------
Q8SQ42_BCL2L1-01        --KEMQVLVS--RIAAWMATYLNDHLEPWIQENGGW-DTF----------
A0A337RYG8_BCL2L10      WETNVGQDCQ--HLVALLCNRLTGRHRAWLEAHDGW-DGF----------
A0A337S3J9_MCL1-04      --INQESCIE--PLAESITDVLVRTKRDWLVKQRGW-DGF----------
                                     :   :   :      *:    **              

A0A337S3J9_MCL1-03      --VEFFHVEDLEGGIR----------NVLLAFAGVAGVGAGLAYLIR---
Q7YRZ9_MCL1-01          --VEFFHVEDLEGGIR----------NVLLAFAGVAGVGAGLAYLIR---
A0A337S3J9_MCL1-02      --PTSLCLAHLLCSEQ----------V-----------------------
A0A337S3J9_MCL1-01      --VEFFHVEDLEGGDK----------A-----------------------
M3WHW2_BCL2A1-01        -----FVRKFEPKSGW-------------LTFLEVTGKICKVLSLLKNYY
A0A2I2UAE3_BCL2L2-      --TALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK--
A0A5F5Y6Y3_BCL2-02      --L--------PRTSY----EL-KSSRALREDVRISPSFLFKD-------
A0A5F5Y6Y3_BCL2-01      --VELYGPSMQPLFDF----SW-LSLKALLSLALVGACITLGAYLGHK--
Q8I008_BCL2-01          --VELYGPSMQPLFDF----SW-LSLKALLSLALVGACITLGAYLGHK--
A0A5F5XYW0_BCL2L1-      --VELYGNNAAAESRK----GQVRTNAETELPQRVCPVLGTTPCLDFAGT
A0A5F5XYW0_BCL2L1-      PQGAHSPEQSSPWSTS----SRERRHDGQGNKQDCSGDKLFCNQLPQNLS
A0A5F5XYW0_BCL2L1-      --GLFYPEFLAQGLRL----GK---------GLASICSMNMRLLLDAG--
Q8SQ42_BCL2L1-01        --VELYGNNAAAESRK----GQERSNRWFLTGMTVAGVVLLGSLFSRK--
A0A337RYG8_BCL2L10      --CLFFS-PMLPSSWR----------RLLVQALLSCFTVMILIYFWRRLL
A0A337S3J9_MCL1-04      --VEFFHVEDLEGGIR----------NVLLAFAGVAGVGAGLAYLIR---
                                                                          

A0A337S3J9_MCL1-03      ------------------------------------
Q7YRZ9_MCL1-01          ------------------------------------
A0A337S3J9_MCL1-02      ------------------------------------
A0A337S3J9_MCL1-01      ------------------------------------
M3WHW2_BCL2A1-01        ------------------------------------
A0A2I2UAE3_BCL2L2-      ------------------------------------
A0A5F5Y6Y3_BCL2-02      ------------------------------------
A0A5F5Y6Y3_BCL2-01      ------------------------------------
Q8I008_BCL2-01          ------------------------------------
A0A5F5XYW0_BCL2L1-      GRDCWPGRWRKPPLGGSDHSAQLPSQGRSSRRRGRC
A0A5F5XYW0_BCL2L1-      ------------------------------------
A0A5F5XYW0_BCL2L1-      ------------------------------------
Q8SQ42_BCL2L1-01        ------------------------------------
A0A337RYG8_BCL2L10      ------------------------------------
A0A337S3J9_MCL1-04      ------------------------------------
                                                            

© 1998-2021Legal notice