Dataset for protein BCL-2-like of organism Felis catus

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A337S3J9_MCL1-01      ------MFGLKRNAVIGLNLY--------------------CGGAGLAAG
A0A337S3J9_MCL1-03      ------MFGLKRNAVIGLNLY--------------------CGGAGLAAG
Q7YRZ9_MCL1-01          ------MFGLKRNAVIGLNLY--------------------CGGAGLAAG
A0A2I2UAE3_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------------------
M3X1R9_BCL2-02          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDAGAAPPGAAPA
M3X1R9_BCL2-01          MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDAGAAPPGAAPA
Q8I008_BCL2-01          MAHAGRTGYDNREIVMKYIHYELPQRGYEWD-----AGDAGAAPPGAAPA
M3XA94_BCL2L1-02        ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
M3XA94_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
M3XA94_BCL2L1-03        ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
Q8SQ42_BCL2L1-01        ------MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESE
A0A337RYG8_BCL2L10      --MADALRERTAQLLTDYLEY--------------------CA-------
A0A337S3J9_MCL1-04      --MFGLKRNAVIGLNL----Y--------------------CGGAGLAAG
                                            *                             

A0A337S3J9_MCL1-01      SGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDAR
A0A337S3J9_MCL1-03      SGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDAR
Q7YRZ9_MCL1-01          SGGASSSGGRLVAVGKEATARREVGGGEAGAVIGGSAGASPPATLAPDAR
A0A2I2UAE3_BCL2L2-      -------------------------------VCGAGPGEGPAADPLH---
M3X1R9_BCL2-02          PGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAAGPALSPVPPVVH---
M3X1R9_BCL2-01          PGIFSSQPGRTPAPARTSPPPPPVAPAAAAAAAAAGPALSPVPPVVH---
Q8I008_BCL2-01          PGIFSSQPGRTPAPARTSPPPPPVAP--AAAAAAAGPALSPVPPVVH---
M3XA94_BCL2L1-02        METPSAINGN---PSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ---
M3XA94_BCL2L1-01        METPSAINGN---PSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ---
M3XA94_BCL2L1-03        METPSAINGN---PSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ---
Q8SQ42_BCL2L1-01        METPSAINGN---PSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ---
A0A337RYG8_BCL2L10      ------------------REPGSPARTPSTPEAA----------------
A0A337S3J9_MCL1-04      SGGASSSGGRLVATGAKDAKPLGGSGAASRKALE----------------
                                                                          

A0A337S3J9_MCL1-01      RVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEE
A0A337S3J9_MCL1-03      RVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEKMEGPAADAIMSPEE
Q7YRZ9_MCL1-01          RVARPSPIGAEGPDVTATPPKLLFFAATRCASPPEEMEGPAADAIMSPEE
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
                                                                          

A0A337S3J9_MCL1-01      ELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEEEEDEL
A0A337S3J9_MCL1-03      ELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEEEEDEL
Q7YRZ9_MCL1-01          ELDGYEPEPLGKRPAVLPLLELVGEASSGPGTDGSLPSTPPPAEEEEDEL
A0A2I2UAE3_BCL2L2-      --------------------------------------------------
M3X1R9_BCL2-02          --------------------------------------------------
M3X1R9_BCL2-01          --------------------------------------------------
Q8I008_BCL2-01          --------------------------------------------------
M3XA94_BCL2L1-02        --------------------------------------------------
M3XA94_BCL2L1-01        --------------------------------------------------
M3XA94_BCL2L1-03        --------------------------------------------------
Q8SQ42_BCL2L1-01        --------------------------------------------------
A0A337RYG8_BCL2L10      --------------------------------------------------
A0A337S3J9_MCL1-04      --------------------------------------------------
                                                                          

A0A337S3J9_MCL1-01      FRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNH
A0A337S3J9_MCL1-03      FRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNH
Q7YRZ9_MCL1-01          FRQSLEIISRYLREQATGAKDAKPLGGSGAASRKALETLRRVGDGVQRNH
A0A2I2UAE3_BCL2L2-      ------------------------------------QAMRAAGDEFETRF
M3X1R9_BCL2-02          ------------------------------------LTLRQAGDDFSRRY
M3X1R9_BCL2-01          ------------------------------------LTLRQAGDDFSRRY
Q8I008_BCL2-01          ------------------------------------LTLRQAGDDFSRRY
M3XA94_BCL2L1-02        -------------------------------------ALREAGDEFELRY
M3XA94_BCL2L1-01        -------------------------------------ALREAGDEFELRY
M3XA94_BCL2L1-03        -------------------------------------ALREAGDEFELRY
Q8SQ42_BCL2L1-01        -------------------------------------ALREAGDEFELRY
A0A337RYG8_BCL2L10      -------------------------------------VLRYLAAQIRQRH
A0A337S3J9_MCL1-04      -------------------------------------TLRRVGDGVQRNH
                                                             .:*  .  .  ..

A0A337S3J9_MCL1-01      E---TAFQGMLRKLDIKNENDVKSLSRVMVHVFSDGVT-NWGRIVTLISF
A0A337S3J9_MCL1-03      E---TAFQGMLRKLDIKNENDVKSLSRVMVHVFSDGVT-NWGRIVTLISF
Q7YRZ9_MCL1-01          E---TAFQGMLRKLDIKNENDVKSLSRVMVHVFSDGVT-NWGRIVTLISF
A0A2I2UAE3_BCL2L2-      R---RTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP--NWGRLVAFFVF
M3X1R9_BCL2-02          R---RDFAEMSSQLHLTPFTARGRFATVVEELFRDGV--NWGRIVAFFEF
M3X1R9_BCL2-01          R---RDFAEMSSQLHLTPFTARGRFATVVEELFRDGV--NWGRIVAFFEF
Q8I008_BCL2-01          R---RDFAEMSSQLHLTPFTARGRFATVVEELFRDGV--NWGRIVAFFEF
M3XA94_BCL2L1-02        R---RAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV--NWGRIVAFFSF
M3XA94_BCL2L1-01        R---RAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV--NWGRIVAFFSF
M3XA94_BCL2L1-03        R---RAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV--NWGRIVAFFSF
Q8SQ42_BCL2L1-01        R---RAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV--NWGRIVAFFSF
A0A337RYG8_BCL2L10      QRFLSAYRGY-------RGNRVELVARLEQDLLSNPQTLSWGHVVALLTF
A0A337S3J9_MCL1-04      E---TAFQGMLRKLDIKNENDVKSLSRVMVHVFSDGVT-NWGRIVTLISF
                              :            .    .  :   :: .    .**.:*::: *

A0A337S3J9_MCL1-01      GAFVAKHLKS-----------------INQESCIEPLAESITDVLVRTKR
A0A337S3J9_MCL1-03      GAFVAKHLKS-----------------INQESCIEPLAESITDVLVRTKR
Q7YRZ9_MCL1-01          GAFVAKHLKS-----------------INQESCIEPLAESITDVLVRTKR
A0A2I2UAE3_BCL2L2-      GAALCAESVN-----------------KEMEPLVGQVQEWMVAYLETRLA
M3X1R9_BCL2-02          GGVMCVESVN-----------------REMSPLVDNIALWMTEYLNRHLH
M3X1R9_BCL2-01          GGVMCVESVN-----------------REMSPLVDNIALWMTEYLNRHLH
Q8I008_BCL2-01          GGVMCVEGVN-----------------REMSPLVDNIALWMTEYLNRHLH
M3XA94_BCL2L1-02        GGALCVESVD-----------------KEMQVLVSRIATWMATYLNDHLE
M3XA94_BCL2L1-01        GGALCVESVD-----------------KEMQVLVSRIATWMATYLNDHLE
M3XA94_BCL2L1-03        GGALCVESVD-----------------KEMQVLVSRIATWMATYLNDHLE
Q8SQ42_BCL2L1-01        GGALCVESVD-----------------KEMQVLVSRIAAWMATYLNDHLE
A0A337RYG8_BCL2L10      AGTLLERPPPGTYLNLTPDQQQELEWETNVGQDCQHLVALLCNRLTGRHR
A0A337S3J9_MCL1-04      GAFVAKHLKS-----------------INQESCIEPLAESITDVLVRTKR
                        .. :                        :       :   :   *     

A0A337S3J9_MCL1-01      DWLVKQRGWDGF------------VEFFHVEDLEGGDK----------A-
A0A337S3J9_MCL1-03      DWLVKQRGWDGF------------VEFFHVEDLEGGIR----------NV
Q7YRZ9_MCL1-01          DWLVKQRGWDGF------------VEFFHVEDLEGGIR----------NV
A0A2I2UAE3_BCL2L2-      DWIHSSGGWAEF------------TALYGDGALEEARRLREGNWASVRTV
M3X1R9_BCL2-02          TWIQDNGGWLIL------------L--------PRTSY----EL-KSSRA
M3X1R9_BCL2-01          TWIQDNGGWDAF------------VELYGPSMQPLFDF----SW-LSLKA
Q8I008_BCL2-01          TWIQDNGGWDAF------------VELYGPSMQPLFDF----SW-LSLKA
M3XA94_BCL2L1-02        PWIQENGGWDTF------------VELYGNNAAAESRK----GQVRTNAE
M3XA94_BCL2L1-01        PWIQENGGWVVIEHQRCARLCAPQGAHSPEQSSPWSTS----SRERRHDG
M3XA94_BCL2L1-03        PWIQENGGWVWT------------GLFYPEFLAQGLRL----GK------
Q8SQ42_BCL2L1-01        PWIQENGGWDTF------------VELYGNNAAAESRK----GQERSNRW
A0A337RYG8_BCL2L10      AWLEAHDGWDGF------------CLFFS-PMLPSSWR----------RL
A0A337S3J9_MCL1-04      DWLVKQRGWDGF------------VEFFHVEDLEGGIR----------NV
                         *:    **                                         

A0A337S3J9_MCL1-01      --------------------------------------------------
A0A337S3J9_MCL1-03      LLAFAGVAGVGAGLAYLIR-------------------------------
Q7YRZ9_MCL1-01          LLAFAGVAGVGAGLAYLIR-------------------------------
A0A2I2UAE3_BCL2L2-      LTGAVALGALVTVGAFFASK------------------------------
M3X1R9_BCL2-02          LREDVRISPSFLFKD-----------------------------------
M3X1R9_BCL2-01          LLSLALVGACITLGAYLGHK------------------------------
Q8I008_BCL2-01          LLSLALVGACITLGAYLGHK------------------------------
M3XA94_BCL2L1-02        TELPQRVCPVLGTTPCLDFAGTGRDCWPGRWRKPPLGGSDHSAQLPSQGR
M3XA94_BCL2L1-01        QGNKQDCSGDKLFCNQLPQNLS----------------------------
M3XA94_BCL2L1-03        ---GLASICSMNMRLLLDAG------------------------------
Q8SQ42_BCL2L1-01        FLTGMTVAGVVLLGSLFSRK------------------------------
A0A337RYG8_BCL2L10      LVQALLSCFTVMILIYFWRRLL----------------------------
A0A337S3J9_MCL1-04      LLAFAGVAGVGAGLAYLIR-------------------------------
                                                                          

A0A337S3J9_MCL1-01      --------
A0A337S3J9_MCL1-03      --------
Q7YRZ9_MCL1-01          --------
A0A2I2UAE3_BCL2L2-      --------
M3X1R9_BCL2-02          --------
M3X1R9_BCL2-01          --------
Q8I008_BCL2-01          --------
M3XA94_BCL2L1-02        SSRRRGRC
M3XA94_BCL2L1-01        --------
M3XA94_BCL2L1-03        --------
Q8SQ42_BCL2L1-01        --------
A0A337RYG8_BCL2L10      --------
A0A337S3J9_MCL1-04      --------
                                

© 1998-2020Legal notice