Dataset for protein BCL-2-like of organism Falco tinnunculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------------------rr
mvraaraarpvpggacfaggswgtaaprgdgvggggtpgsdragrhkqgrhkapsrarpgeaacaaqrnvpivqahpg--
                                                                  gpgifg mpqea m
                                                                         g      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                .*    :                                                         
gydnreivlkyihyklsQrgydw---------------------------------------------------------
----prtrrglyvpysp kypsyrgvtptppgpcrkrgrkrgrkwtgaaslrprraprrvpsrhrrhisgsdahrraarr
ssssmglaiffvs f a dalq                                                          
 da   g ed fr        a                                                          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------sagedraplppglsppaaaaavaaaaaagtssdhtglvsphpeppgsla
scavaamfavkrnavisfnlycggglalapaa------------------------------p-------g-a-----a-
                               -qlggpteprtdvvaet emdgvvpwspswr-pvsrvln-q-vhrs -i
                                p  eed n  afa ae    aelng  ash eapht i a aa r  e
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         :  .                                                                   
ashvppaeglrpapqvvhl-------------------------------------------------------------
---ivqrahvpqg----a-wspeeeldgcepepergpagdslpgppdglrqdslelisrylreaagesepgakklfpgll
vhgal esd  qtra-h                                                             
gce a   a    grp                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 **  .. .  .    :  :  :: :         .  *    * ** .****::::: **. :
----------------tLRqagdefsrryqrdfaqmsgqlhitpftarqr-fvaVveelFrDG-vNWGRivaffsFGgvm
ggpgrpgdavmekale-  rvassvqqqteqalspllskidlqsvevygsivnq mnhv s  vt    vmtlie  all
                v  ni nglmlkhrlt qgftq     kgadlk   eg aa k a  n        i t   fv
                       ed   e  kd  d      e  a    ce                        a 
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .            :   :*  :      *:  :***                              :        
cvesvnremspl---vdsiaawmTeylnrhlhnWiqdnGGWe-fv-----------r------lsw-----llsfatvag
tkklqsknvrvtgeeksrlvyii taivsskre lmsq   dr--dlygnsdaaev-ppqntfntkssrrtiwvtvsita
a h keigqqlc   igq srf   tnn dp  de    -g  effrvna   m kliersfkgiilns mtlslggp
     dh  ek     e          id  a    a     a       e       gfdg  e fe ki  cg k   
                                                            a               g   

       490       500       510       520       
....:....|....:....|....:....|....:....|....:..
                                               
vwalgayl-rk------------------------------------
mltv----s--yyakrrifecgrtaygctvlhsscevaflwrslllp
lilsvssmihend                                  
ggialfl g a                                    
cf      f                                      
© 1998-2023Legal notice