Dataset for protein BCL-2-like of organism Falco tinnunculus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C4TWS5_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Falco tinnunculus GN=BCL2L1 (length=230 residues).
MSSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNGSPSWHPPASHVVNGAAVHRSSLEVHEIVQA
ADVRQALREAGDEFELRYRQAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLV
GRIVAWMTTYLTDHLDPWIQENGGWERFVDLYGNNAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C4U2H6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Falco tinnunculus GN=MCL-1 (length=512 residues).
MVRAARAARPVPGGACFAGGSWGTAAPRGDGVGGGGTPGSDRAGRHKQGRHKAPSRARPGEAACAAGPGVPGVGPQEARR
GDASPRGRRGLFRPFSPQKAPAWRGVTPTPPGPCRKRGRKRGRKWTGAASLRPRRAPRRVPSRHRRHISGSDAHRRAARR
SCAVAAMFAVKRNAVISFNLYCGGGLALAPASPGGGPTPPPPAVVPATAAAAAEVPWAAASRPEVPRTLIGQAAAPRSLI
GCGAAPRAALPPGGRPAALWSPEEELDGCEPEPERGPAGDSLPGPPDGLRQDSLELISRYLREAAGESEPGAKKLFPGLL
GGPGRPGDAVMEKALETLRRVGNGVMQKHELTFQGMLQKLDIQKEEDLQSVCEVAAHVFSDGVTNWGRVVTLISFGAFVA
KHLKSINQEKCISSLARIITDALVSSKREWLMSQGGWDGFVDFFRVEDLEGSIRNILMVFAGVAGLGASLAYMIRANDAK
RRIFECGRTAYGCTVLHSSCEVAFLWRSLLLP
>gnl|bcl2dbpro|A0A8C4U538_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Falco tinnunculus GN=BCL-2 (length=229 residues).
QRNIFIVQAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAVAAAAAAGTSSDHTGLVSPHPE
PPGSAAASHVPPAEGLRPAPQVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAF
FEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWVRPPIARSLSWLWCTASGAPGWAV
>gnl|bcl2dbpro|A0A8C4U538_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Falco tinnunculus GN=BCL-2 (length=242 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGLSPPAAAAAVAAAAAAGTSSDHTGLVSPHPEPPGSAAA
SHVPPAEGLRPAPQVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVM
CVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWISLKTILSLVLVGACITLGAYLG
HK
>gnl|bcl2dbpro|A0A8C4U5U5_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Falco tinnunculus GN=BCL2A1 (length=174 residues).
MGTAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALKPFLDKIDITSVAVAKRIFNGVMEEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
AMFIAVFSLFREYY
© 1998-2023Legal notice