Dataset for protein BCL-2-like of organism Falco tinnunculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4U2H6_MCL1-01      MVRAARAARPVPGGACFAGGSWGTAAPRGDGVGGGGTPGSDRAGRHKQGR
A0A8C4U5U5_BCL2A1-      --------------------------------------------------
A0A8C4U538_BCL2-02      --------------------------------------------------
A0A8C4TWS5_BCL2L1-      --------------------------------------------------
A0A8C4U538_BCL2-01      --------------------------------------------------
                                                                          

A0A8C4U2H6_MCL1-01      HKAPSRARPGEAACAAGPGVPGVGPQEARRGDASPRGRRGLFRPFSPQKA
A0A8C4U5U5_BCL2A1-      ----------------------------------MGTAEFYYVYYLAQDY
A0A8C4U538_BCL2-02      -----------------------MAHPGRRGYDNREIVLKYIHYKLSQRG
A0A8C4TWS5_BCL2L1-      -----------------------------MSSSNRELVIDFVSYKLSQKG
A0A8C4U538_BCL2-01      ----------------QRNIFIVQAHPGRRGYDNREIVLKYIHYKLSQRG
                                                                      .*  

A0A8C4U2H6_MCL1-01      PAWRGVTPTPPGPCRKRGRKRGRKWTGAASLRPRRAPRRVPSRHRRHISG
A0A8C4U5U5_BCL2A1-      LQY-----------------------------------------------
A0A8C4U538_BCL2-02      YDW-----------------------------------------------
A0A8C4TWS5_BCL2L1-      YSW-----------------------------------------------
A0A8C4U538_BCL2-01      YDW-----------------------------------------------
                          :                                               

A0A8C4U2H6_MCL1-01      SDAHRRAARRSCAVAAMFAVKRNAVISFNLYCGGGLALAPASPGGGPTPP
A0A8C4U5U5_BCL2A1-      --------------------------------------------------
A0A8C4U538_BCL2-02      -----------------------------------------AAGEDRAPL
A0A8C4TWS5_BCL2L1-      -----------------------------------------SQLEEEDEN
A0A8C4U538_BCL2-01      -----------------------------------------AAGEDRAPL
                                                                          

A0A8C4U2H6_MCL1-01      PPAVVPATAAAAAEVPWAAASRPEVPRTLIGQAAAPRSLIGCGAAPRAAL
A0A8C4U5U5_BCL2A1-      -------------------------------------------VLQESHL
A0A8C4U538_BCL2-02      PPGLSPPAAAAAVAAAAAAGTSSDHTGLVSPHPEPPGSAAASHVPPAEGL
A0A8C4TWS5_BCL2L1-      RTDFAAEEAEMDGVLNGSPSWHPPASHVVNGAAVHRSSLEVHEIVQAADV
A0A8C4U538_BCL2-01      PPGLSPPAAAAAVAAAAAAGTSSDHTGLVSPHPEPPGSAAASHVPPAEGL
                                                                         :

A0A8C4U2H6_MCL1-01      PPGGRPAALWSPEEELDGCEPEPERGPAGDSLPGPPDGLRQDSLELISRY
A0A8C4U5U5_BCL2A1-      GPAQTRVAH-----------------------------------------
A0A8C4U538_BCL2-02      RPAPQVVHL-----------------------------------------
A0A8C4TWS5_BCL2L1-      RQA-----------------------------------------------
A0A8C4U538_BCL2-01      RPAPQVVHL-----------------------------------------
                          .                                               

A0A8C4U2H6_MCL1-01      LREAAGESEPGAKKLFPGLLGGPGRPGDAVMEKALETLRRVGNGVMQKHE
A0A8C4U5U5_BCL2A1-      ------------------------------------VLRNIASSLQDQTE
A0A8C4U538_BCL2-02      ------------------------------------TLRQAGDEFSRRYQ
A0A8C4TWS5_BCL2L1-      -------------------------------------LREAGDEFELRYR
A0A8C4U538_BCL2-01      ------------------------------------TLRQAGDEFSRRYQ
                                                             **  .. .  .  

A0A8C4U2H6_MCL1-01      LTFQGMLQKLDIQKEEDLQS-VCEVAAHVFSDGVTNWGRVVTLISFGAFV
A0A8C4U5U5_BCL2A1-      EALKPFLDKIDITSVAVAKRIFNGVMEEKFADGNTNWGRIMTIFTFGGLL
A0A8C4U538_BCL2-02      RDFAQMSGQLHLTPFTARGR-FVAVVEELFRDG-VNWGRIVAFFEFGGVM
A0A8C4TWS5_BCL2L1-      QAFSDLTSQLHITPGTAYQS-FEQVVNELFRDG-VNWGRIVAFFSFGGAL
A0A8C4U538_BCL2-01      RDFAQMSGQLHLTPFTARGR-FVAVVEELFRDG-VNWGRIVAFFEFGGVM
                          :  :  :: :         .  *    * ** .****::::: **. :

A0A8C4U2H6_MCL1-01      AKHLKSINQEKC---ISSLARIITDALVSSKREWLMSQGGWDGFVDFFRV
A0A8C4U5U5_BCL2A1-      TKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWE--------
A0A8C4U538_BCL2-02      CVESVNREMSPL---VDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGN
A0A8C4TWS5_BCL2L1-      CVESVDKEMRVL---VGRIVAWMTTYLTDHLDPWIQENGGWERFVDLYGN
A0A8C4U538_BCL2-01      CVESVNREMSPL---VDSIAAWMTEYLNRHLHNWIQDNGGW---------
                             .            :   :*  :      *:  :***         

A0A8C4U2H6_MCL1-01      ED-----------LEGSIRNILMVFAGVAGLGASLAYMIRANDAKRRIFE
A0A8C4U5U5_BCL2A1-      ----------NGFLTKFERRSLLSFSKITAMFIAVFSLFREYY-------
A0A8C4U538_BCL2-02      S----MRPLFD--FSWISLKTILSLVLVGACITLGAYLGHK---------
A0A8C4TWS5_BCL2L1-      NAAAEVRKGQETFNKW-----LLTGATVAGVLLLGSLLSRK---------
A0A8C4U538_BCL2-01      -----VRPPIARSLSW-----LWCTASGAPGWAV----------------
                                             :                            

A0A8C4U2H6_MCL1-01      CGRTAYGCTVLHSSCEVAFLWRSLLLP
A0A8C4U5U5_BCL2A1-      ---------------------------
A0A8C4U538_BCL2-02      ---------------------------
A0A8C4TWS5_BCL2L1-      ---------------------------
A0A8C4U538_BCL2-01      ---------------------------
                                                   

© 1998-2023Legal notice