Dataset for protein Mcl-1 of organism Esox lucius

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          : .       *. :        
-------------------------a-----s-------g-el----p-----pavfskskmsl-isqGtgec-------
msgvypqgsnftsmsksdprdided-llkgm-aeeldal-y--qemd-enpmlmrgsrqrdqtkkspt vfdrdarptkl
     lsyeyrqmrvtvtvtrftttminvrngvvyssyselpshygsdvgalrila   q  dvdlgn  a tpv     
         allynlskslkgagis  krqe gqgelpecakcctfp tdticvyl                        
          can                               v      ya                           
            d                                                                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               : .     :        *:   *: :  :  : .             * 
-------------------------------vdecrnras--------LdtetRqlvksflgdftghl---------kPr
evnmtkpnvldsrlsdladdsddslpctplmlldhlektahcpsgnev ehad edlvpltrekkerafvpkeghgqi i
                               iykrsagl           nd    ien  e y  ls         q  
                                t                                 c             
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :: .    :: .: .          .::    *  ...    :     :*:              :*.*  .*  .: .
wneskalstmkrvvtksldkhrysyngml--ytLslgdspgdyvgfvgviAn-------------rlFaDgttNwgrvvs
neqitlepeleqalknataaemcdiaaiigmsr msdkqyyhdlrttstv kteginsvvkpdpfki p epp ptniee
cn s v   e  gevi   t a k      k n  -  am  its                s  s  v      i 
               dt                      t                                      a 
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :                                                    .. .*.  *::  . :.::  .: *:
ll---------------------------------------------------afgtvVcryLkdkgkdncveavgqeIs
tvqqiqtndssllevnlnnikdipiptlkeifeamktnthveslsiaatrsndpvaaa aem qenttlqslniesnf t
                                                     g  f  sqh    g         
                                                                    e           
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :*     :.:**:   :              :*:  : : :*:: :    *                          
myllTdqrdwlvkNNswdgf--------------vEffrvae-eStlrnvlltFagfgprlaalimlvr-----------
segm aivkaman  tlteikidnqrqklgdscem iasmldnn silkigyh tqvagaarmakait-nndllymgfpt
th    hka      a                      h e p   v  t va daqyaiwvtyalyivtgksivylcea
                                                   m   v rvsgirfv---yqspnspw    
                                                          tlm h srvgm   aheq    
                                                           f      ad       h    

       410  
....:....|..
            
------------
cldlssrrqslt
 dcdph qfrfr
            
            
            
© 1998-2022Legal notice