Dataset for protein Mcl-1 of organism Esox lucius

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lsysyrmnmsksdprdidedailkgmsaeeldaleyelqemdpenamlpagfrqrdqtkksptgvfdrdalldhlektal
   ealqyl   lt att                    tmlnvq gvvgslysgaplcyf                    
     cld                                                                        
      a                                                                         
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------l-p----k--r--v---g-g--p---------e--e-lkn-td----dia-----------------------
ehadred-v-ftse-kg-af-pke-h-qi-ineqitlep-le-a---h--aemc---ailgmytlmsnkqyydalgttgt
    mspvy qggsftsmvvdtvn taitavrrtesgqy vpmtkpsalgsrvstlr                       
      g c aa n sk dt lgk f ds lkpr   kl sn g ecvv pdldpy                        
                                           c                                    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .    : :..: .            ::.:  .*::  * : .    *  ::          : . : .: 
-------nsvfskskmslisqgtgecvdecrnrasldtetrqLvksfLgdftghlkPrwneskalstmkrvvtesldkhr
iantegimrsvkpdpfkifpdeppnptnveetlqqiqnndss levn nnikeipi tlkq--------q-ifkamktnt
    ddsilllpct l-mvtecsaglsycrsgnev   d    nl rey dlsq  c  n s v   -  gdvia   
       dd    q            ihkp                  e    c                    t     
       vy                                                                       
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:     :  *.:         .   :*: *  : . :  .: * .  .  :   :*  .: * :  :  : .   * *  
ysyngmlyrLslgds-gdyvrfvsvvAnrLfadgttnwgrvvSllafgtvvcrylKdkgkdNcveavgqeismylLtDqr
h-----ves cidatprsddgvafai em qentvlqslnie nfitsagmtaiv amann tlteikidnqrqk g sc
 a k  ist   a qt hnmp its  ks  s         i  v ea sqh    g    l      th    hk
        k              g                 a                  e                   
                                                                                
                                                                                

       330       340       350       360       370       380       390
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            :*:  : : :*:: :    *                                      
dwlvknnswdgfvEffrvae-eStlrnvlltFagfgprlaalimlvr-----------------------
e-----------m iasmldnn silkigyh tqvagaarmakait-nndllymgfptcldlssrrqslt
a      a        h e p   v  t va daqyaiwvtyalyivtgksivylcea dcdph qfrfr
                             m   v rvsgirfv---yqspnspw                
                                    tlm h srvgm   aheq                
                                     f      ad       h                
© 1998-2022Legal notice