Dataset for protein Mcl-1 of organism Esox lucius

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A3P8Y1W8_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=345 residues).
EACLYMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPENAMLPAGFRQRDQTKKSPTGVFDRDALLDHLEKTALEHA
DREDLVPFTGEKKGRAFVPKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGTTGTIAN
TEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTNDSSLLEVNLNNIKDIPIPTLKEIFEAMKTNTHVESLSIAATRSN
DPVAFAVAEMLQENTTLQSLNIESNFITSEGMTAIVKAMANNNTLTEIKIDNQRQKLGDSCEMEIASMLENNSSILKIGY
HFTQQGPRARAAIAITRNNDLSEHL
>gnl|bcl2dbpro|A0A3P8Y1W8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=351 residues).
LSYSYRQNMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPENAMLPAGFRQRDQTKKSPTGVFDRDALLDHLEKTAL
EHADREDLVPFTGEKKGRAFVPKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGTTGT
IANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTNDSSLLEVNLNNIKDIPIPTLKEIFEAMKTNTHVESLSIAAT
RSNDPVAFAVAEMLQENTTLQSLNIESNFITSEGMTAIVKAMANNNTLTEIKIDNQRQKLGDSCEMEIASMLENNSSILK
IGYHFTQQGPRARAAIAITRNNDLIRQQRLR
>gnl|bcl2dbpro|A0A3P8Y1W8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=358 residues).
LADMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPENAMLPAGFRQRDQTKKSPTGVFDRDALLDHLEKTALEHADR
EDLVPFTGEKKGRAFVPKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQYYDALGTTGTIANTE
GINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTNDSSLLEVNLNNIKDIPIPTLKEIFEAMKTNTHVESLSIAATRSNDP
VAFAVAEMLQENTTLQSLNIESNFITSEGMTAIVKAMANNNTLTEIKIDNQRQKLGDSCEMEIASMLENNSSILKIGYHF
TQQGPRARAAIAITRNNDLIVYGFPTCDDLSHRRFSFT
>gnl|bcl2dbpro|A0A3P8Y1W8_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=304 residues).
MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKMDVDLGNGTADTPVRPTKLEVNMTKPNVLDS
RLSDLADDSDDSLPCTPLMVTECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNKSLVTMKRVVGDVIAKH
TYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGKGNCVELVGQEISTYLLTDQR
AWLVKNNAWDGFVEFFHVEDPESSVRNTLMAFAGVAGIGATLALLIRQSPAHPWGCEACLCDPS
>gnl|bcl2dbpro|A0A3P8Y1W8_MCL1-05 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=287 residues).
MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTGPLCPAASSKSKMDVDLGNGTADTPVRPTKLEVNMTKPNVLDS
RLSDLADDSDDSLPCTPLMVTECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLSQPRWKQNKSLVTMKRVVGDVIAKH
TYAYKGMISKLCLDDQGDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGKGNCVELVGQEISTYLLTDQR
AWLVKNNAWDGFVEFFHVEDPESSVRNTLMAFAGVAGIGATLALLIR
>gnl|bcl2dbpro|A0A6Q2XQM7_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=200 residues).
MRVFSKSKMSLISQGTGECVDECRNRASLDTETRQLVKSFLGDFTEHLKPRWNESKALSTMKQVVTKSLDKHRYSYNGML
YRLSLGDSPGDYVRFVSVIANRLFADGTTNWGRVVSLLAFGTVVCRYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNN
SWDGFVEFFRVAEESTLRNVLLTFAGFGAALAMLKMVGYQ
>gnl|bcl2dbpro|A0A6Q2XQM7_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=215 residues).
CLECHVPYAVYLFSKSKMSLISQGTGECVDECRNRASLDTETRQLVKSFLGDFTEHLKPRWNESKALSTMKQVVTKSLDK
HRYSYNGMLYRLSLGDSPGDYVRFVSVIANRLFADGTTNWGRVVSLLAFGTVVCRYLKDKGKDNCVEAVGQEISMYLLTD
QRDWLVKNNSWDGFVEFFRVAEESTLRNVLLTFAGFGAALAMLKMYVVTGKSLYM
>gnl|bcl2dbpro|A0A6Q2XXK6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=252 residues).
MSGVYPQGSNFTSRVTVTVKGFGISALKRRESGQYESPEGLKSHTGPDVDTIRILVFSKQKMSLISQGTGECIYERRNRA
SLDTETRQLVKSFLEEFTGCLKPRCNESKALSTMKRVVTETLDKHRYSYNGMLYTLSLDDSTGHDVGFVGVVANRLFADG
VTNWGRVVSLLAFGAAVCRYLKDKGKENCVEAVGQEISMHLLTDHKDWLVKNNSWDGFVEFFRVAEESTLRNVLVTFAAF
AGFWAALVMLDM
>gnl|bcl2dbpro|A0A6Q2Y9Q3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=252 residues).
MSGVYPQGSNFTSRVTVTVKGFGISALKRRESGQYESPEGLKSHTGPDVDTIRILVFSKQKMSLISQGTGECIYKRRNRA
SLDTETRQLVKSFLEEFTGCLKPRCNESKALSTMKRVVTETLDKHRYSYNGMLYTLSLDDSTGHDVGFVGVVANRLFADG
VTNWGRVVSLLAFGAAVCRYLKDKGKENCVEAVGQEISMHLLTDHKDWLVKNNSWDGFVEFFRVAEESTLRNVLVTFAAF
AVSMVHYIRAVY
>gnl|bcl2dbpro|A0A6Q2YT18_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=206 residues).
MRVFSKSKMSLISQGTGECVDECRNRASLDTETRQLVKSFLGDFTEHLKPRWNESKALSTMKQVVTKSLDKHRYSYNGML
YRLSLGDSPGDYVRFVSVIANRLFADGTTNWGRVISLLAFGTVVCRYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNN
SWDGFVEFFRVAEESTLRNVLLTFAGFRAALAMLKMYVVTGKNLYM
>gnl|bcl2dbpro|A0A6Q2YT18_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Esox lucius GN=MCL-1 (length=195 residues).
MRVFSKSKMSLISQGTGECVDECRNRASLDTETRQLVKSFLGDFTEHLKPRWNESKALSTMKQVVTKSLDKHRYSYNGML
YRLSLGDSPGDYVRFVSVIANRLFADGTTNWGRVISLLAFGTVVCRYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNN
SWDGFVEFFRVAEESTLRNVLLTFDVVYTLWIRFS
© 1998-2022Legal notice