Dataset for protein Mcl-1 of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8Y1W8_MCL1-01      -----LSYSYRQNMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPEN
A0A3P8Y1W8_MCL1-03      --------EACLYMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPEN
A0A3P8Y1W8_MCL1-02      ----------LADMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPEN
A0A3P8Y1W8_MCL1-04      ------------MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTG
A0A3P8Y1W8_MCL1-05      ------------MNLSKSLTRATTTMLNVQNGVVGSLYSGAPLCYFSPTG
A0A6Q2YT18_MCL1-01      --------------------------------------------------
A0A6Q2XQM7_MCL1-01      --------------------------------------------------
A0A6Q2YT18_MCL1-02      --------------------------------------------------
A0A6Q2XQM7_MCL1-02      ---------------------------------------CLECHV-----
A0A6Q2XXK6_MCL1-01      MSGVYPQGSNFTSRVTVTVKGFGISALKRRESGQYESPEGLKSHTGPDVD
A0A6Q2Y9Q3_MCL1-01      MSGVYPQGSNFTSRVTVTVKGFGISALKRRESGQYESPEGLKSHTGPDVD
                                                                          

A0A3P8Y1W8_MCL1-01      AMLPAGFRQRDQTKKSPTGVFDRDA-------------------------
A0A3P8Y1W8_MCL1-03      AMLPAGFRQRDQTKKSPTGVFDRDA-------------------------
A0A3P8Y1W8_MCL1-02      AMLPAGFRQRDQTKKSPTGVFDRDA-------------------------
A0A3P8Y1W8_MCL1-04      PLCPAASSKSKMDVDLGNGTADTPVRPTKLEVNMTKPNVLDSRLSDLADD
A0A3P8Y1W8_MCL1-05      PLCPAASSKSKMDVDLGNGTADTPVRPTKLEVNMTKPNVLDSRLSDLADD
A0A6Q2YT18_MCL1-01      ---MRVFSKSKMSL-ISQGTGEC---------------------------
A0A6Q2XQM7_MCL1-01      ---MRVFSKSKMSL-ISQGTGEC---------------------------
A0A6Q2YT18_MCL1-02      ---MRVFSKSKMSL-ISQGTGEC---------------------------
A0A6Q2XQM7_MCL1-02      PYAVYLFSKSKMSL-ISQGTGEC---------------------------
A0A6Q2XXK6_MCL1-01      TIRILVFSKQKMSL-ISQGTGEC---------------------------
A0A6Q2Y9Q3_MCL1-01      TIRILVFSKQKMSL-ISQGTGEC---------------------------
                                : .       *. :                            

A0A3P8Y1W8_MCL1-01      -----------LLDHLEKTA--------LEHADREDLVPFTGEKKGRAFV
A0A3P8Y1W8_MCL1-03      -----------LLDHLEKTA--------LEHADREDLVPFTGEKKGRAFV
A0A3P8Y1W8_MCL1-02      -----------LLDHLEKTA--------LEHADREDLVPFTGEKKGRAFV
A0A3P8Y1W8_MCL1-04      SDDSLPCTPLMVTECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLS--
A0A3P8Y1W8_MCL1-05      SDDSLPCTPLMVTECSAGLSHCPSGNEVLDNDTRQLIENLLRDYTGLS--
A0A6Q2YT18_MCL1-01      -----------VDECRNRAS--------LDTETRQLVKSFLGDFTEHL--
A0A6Q2XQM7_MCL1-01      -----------VDECRNRAS--------LDTETRQLVKSFLGDFTEHL--
A0A6Q2YT18_MCL1-02      -----------VDECRNRAS--------LDTETRQLVKSFLGDFTEHL--
A0A6Q2XQM7_MCL1-02      -----------VDECRNRAS--------LDTETRQLVKSFLGDFTEHL--
A0A6Q2XXK6_MCL1-01      -----------IYERRNRAS--------LDTETRQLVKSFLEEFTGCL--
A0A6Q2Y9Q3_MCL1-01      -----------IYKRRNRAS--------LDTETRQLVKSFLEEFTGCL--
                                   : .     :        *:   *: :  :  : .     

A0A3P8Y1W8_MCL1-01      PKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQY
A0A3P8Y1W8_MCL1-03      PKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQY
A0A3P8Y1W8_MCL1-02      PKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQY
A0A3P8Y1W8_MCL1-04      -------QPRWKQNKSLVTMKRVVGDVIAKHTYAYKGMI--SKLCLDDQ-
A0A3P8Y1W8_MCL1-05      -------QPRWKQNKSLVTMKRVVGDVIAKHTYAYKGMI--SKLCLDDQ-
A0A6Q2YT18_MCL1-01      -------KPRWNESKALSTMKQVVTKSLDKHRYSYNGML--YRLSLGDSP
A0A6Q2XQM7_MCL1-01      -------KPRWNESKALSTMKQVVTKSLDKHRYSYNGML--YRLSLGDSP
A0A6Q2YT18_MCL1-02      -------KPRWNESKALSTMKQVVTKSLDKHRYSYNGML--YRLSLGDSP
A0A6Q2XQM7_MCL1-02      -------KPRWNESKALSTMKQVVTKSLDKHRYSYNGML--YRLSLGDSP
A0A6Q2XXK6_MCL1-01      -------KPRCNESKALSTMKRVVTETLDKHRYSYNGML--YTLSLDDST
A0A6Q2Y9Q3_MCL1-01      -------KPRCNESKALSTMKRVVTETLDKHRYSYNGML--YTLSLDDST
                                *  :: .    :: .: .          .::    *  ... 

A0A3P8Y1W8_MCL1-01      YDALGTTGTIANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTNDS
A0A3P8Y1W8_MCL1-03      YDALGTTGTIANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTNDS
A0A3P8Y1W8_MCL1-02      YDALGTTGTIANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTNDS
A0A3P8Y1W8_MCL1-04      GDDMGFITSVAK-------------SLFSDGTTNWGRIASLV--------
A0A3P8Y1W8_MCL1-05      GDDMGFITSVAK-------------SLFSDGTTNWGRIASLV--------
A0A6Q2YT18_MCL1-01      GDYVRFVSVIAN-------------RLFADGTTNWGRVISLL--------
A0A6Q2XQM7_MCL1-01      GDYVRFVSVIAN-------------RLFADGTTNWGRVVSLL--------
A0A6Q2YT18_MCL1-02      GDYVRFVSVIAN-------------RLFADGTTNWGRVISLL--------
A0A6Q2XQM7_MCL1-02      GDYVRFVSVIAN-------------RLFADGTTNWGRVVSLL--------
A0A6Q2XXK6_MCL1-01      GHDVGFVGVVAN-------------RLFADGVTNWGRVVSLL--------
A0A6Q2Y9Q3_MCL1-01      GHDVGFVGVVAN-------------RLFADGVTNWGRVVSLL--------
                           :     :*:              :*.*  .*  .: . :        

A0A3P8Y1W8_MCL1-01      SLLEVNLNNIKDIPIPTLKEIFEAMKTNTHVESLSIAATRSNDPVAFAVA
A0A3P8Y1W8_MCL1-03      SLLEVNLNNIKDIPIPTLKEIFEAMKTNTHVESLSIAATRSNDPVAFAVA
A0A3P8Y1W8_MCL1-02      SLLEVNLNNIKDIPIPTLKEIFEAMKTNTHVESLSIAATRSNDPVAFAVA
A0A3P8Y1W8_MCL1-04      -------------------------------------------GFGAVVS
A0A3P8Y1W8_MCL1-05      -------------------------------------------GFGAVVS
A0A6Q2YT18_MCL1-01      -------------------------------------------AFGTVVC
A0A6Q2XQM7_MCL1-01      -------------------------------------------AFGTVVC
A0A6Q2YT18_MCL1-02      -------------------------------------------AFGTVVC
A0A6Q2XQM7_MCL1-02      -------------------------------------------AFGTVVC
A0A6Q2XXK6_MCL1-01      -------------------------------------------AFGAAVC
A0A6Q2Y9Q3_MCL1-01      -------------------------------------------AFGAAVC
                                                                    .. .*.

A0A3P8Y1W8_MCL1-01      EMLQENTTLQSLNIESNFITSEGMTAIVKAMANNNTLTEIKIDNQRQKLG
A0A3P8Y1W8_MCL1-03      EMLQENTTLQSLNIESNFITSEGMTAIVKAMANNNTLTEIKIDNQRQKLG
A0A3P8Y1W8_MCL1-02      EMLQENTTLQSLNIESNFITSEGMTAIVKAMANNNTLTEIKIDNQRQKLG
A0A3P8Y1W8_MCL1-04      QHLKEMGKGNCVELVGQEISTYLLTDQRAWLVKNNAWDGF----------
A0A3P8Y1W8_MCL1-05      QHLKEMGKGNCVELVGQEISTYLLTDQRAWLVKNNAWDGF----------
A0A6Q2YT18_MCL1-01      RYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNNSWDGF----------
A0A6Q2XQM7_MCL1-01      RYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNNSWDGF----------
A0A6Q2YT18_MCL1-02      RYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNNSWDGF----------
A0A6Q2XQM7_MCL1-02      RYLKDKGKDNCVEAVGQEISMYLLTDQRDWLVKNNSWDGF----------
A0A6Q2XXK6_MCL1-01      RYLKDKGKENCVEAVGQEISMHLLTDHKDWLVKNNSWDGF----------
A0A6Q2Y9Q3_MCL1-01      RYLKDKGKENCVEAVGQEISMHLLTDHKDWLVKNNSWDGF----------
                          *::  . :.::  .: *:   :*     :.:**:   :          

A0A3P8Y1W8_MCL1-01      DSCEMEIASMLENNSSILKIGYHFTQQGPRARAAIAITRNNDLI------
A0A3P8Y1W8_MCL1-03      DSCEMEIASMLENNSSILKIGYHFTQQGPRARAAIAITRNNDLSEHL---
A0A3P8Y1W8_MCL1-02      DSCEMEIASMLENNSSILKIGYHFTQQGPRARAAIAITRNNDLIVYGFPT
A0A3P8Y1W8_MCL1-04      ----VEFFHVEDPESSVRNTLMAFAGVAGIGATLALLIRQSPAHPWGCEA
A0A3P8Y1W8_MCL1-05      ----VEFFHVEDPESSVRNTLMAFAGVAGIGATLALLIR-----------
A0A6Q2YT18_MCL1-01      ----VEFFRVAE-ESTLRNVLLTFDVVYTLWIRFS---------------
A0A6Q2XQM7_MCL1-01      ----VEFFRVAE-ESTLRNVLLTFAGFGAALAMLKMVG------YQ----
A0A6Q2YT18_MCL1-02      ----VEFFRVAE-ESTLRNVLLTFAGFRAALAMLKMYVVTGKNLYM----
A0A6Q2XQM7_MCL1-02      ----VEFFRVAE-ESTLRNVLLTFAGFGAALAMLKMYVVTGKSLYM----
A0A6Q2XXK6_MCL1-01      ----VEFFRVAE-ESTLRNVLVTFAAFAGFWAALVMLDM-----------
A0A6Q2Y9Q3_MCL1-01      ----VEFFRVAE-ESTLRNVLVTFAAFAVSMVHYIRAVY-----------
                            :*:  : : :*:: :    *                          

A0A3P8Y1W8_MCL1-01      ------RQQRLR
A0A3P8Y1W8_MCL1-03      ------------
A0A3P8Y1W8_MCL1-02      CDDLSHRRFSFT
A0A3P8Y1W8_MCL1-04      CLCDPS------
A0A3P8Y1W8_MCL1-05      ------------
A0A6Q2YT18_MCL1-01      ------------
A0A6Q2XQM7_MCL1-01      ------------
A0A6Q2YT18_MCL1-02      ------------
A0A6Q2XQM7_MCL1-02      ------------
A0A6Q2XXK6_MCL1-01      ------------
A0A6Q2Y9Q3_MCL1-01      ------------
                                    

© 1998-2022Legal notice