Dataset for protein Mcl-1 of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6Q2YT18_MCL1-01      --------------------------------------------------
A0A6Q2XQM7_MCL1-01      --------------------------------------------------
A0A6Q2YT18_MCL1-02      --------------------------------------------------
A0A6Q2XQM7_MCL1-02      --------------------------------------------------
A0A6Q2XXK6_MCL1-01      --------------------------------------------------
A0A6Q2Y9Q3_MCL1-01      --------------------------------------------------
A0A3P8Y1W8_MCL1-05      ------MNLSKSLTRATT--------------------TMLNVQNGVVGS
A0A3P8Y1W8_MCL1-04      ------MNLSKSLTRATT--------------------TMLNVQNGVVGS
A0A3P8Y1W8_MCL1-01      LSYSYRQNMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPENAMLPA
A0A3P8Y1W8_MCL1-03      ---EACLYMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPENAMLPA
A0A3P8Y1W8_MCL1-02      -----LADMSKSDPRDIDEDAILKGMSAEELDALEYELQEMDPENAMLPA
                                                                          

A0A6Q2YT18_MCL1-01      --------------------------------------------------
A0A6Q2XQM7_MCL1-01      --------------------------------------------------
A0A6Q2YT18_MCL1-02      --------------------------------------------------
A0A6Q2XQM7_MCL1-02      --------------------------------------------------
A0A6Q2XXK6_MCL1-01      ----------------------------------MSGVYPQGSNFTSRVT
A0A6Q2Y9Q3_MCL1-01      ----------------------------------MSGVYPQGSNFTSRVT
A0A3P8Y1W8_MCL1-05      LYSGAPLCYFSPTG----------------------PLCPAASSKSKMDV
A0A3P8Y1W8_MCL1-04      LYSGAPLCYFSPTG----------------------PLCPAASSKSKMDV
A0A3P8Y1W8_MCL1-01      GFRQRDQTKKSPTGVFDRDALLDHLEKTALEHADREDLVPFTGEKKGRAF
A0A3P8Y1W8_MCL1-03      GFRQRDQTKKSPTGVFDRDALLDHLEKTALEHADREDLVPFTGEKKGRAF
A0A3P8Y1W8_MCL1-02      GFRQRDQTKKSPTGVFDRDALLDHLEKTALEHADREDLVPFTGEKKGRAF
                                                                          

A0A6Q2YT18_MCL1-01      --------------------------------------------------
A0A6Q2XQM7_MCL1-01      --------------------------------------------------
A0A6Q2YT18_MCL1-02      --------------------------------------------------
A0A6Q2XQM7_MCL1-02      -----------------------CLECHV-----PYA-------------
A0A6Q2XXK6_MCL1-01      VTVKGFGISALKRRESGQYESPEGLKSHTGPDVDTIR-------------
A0A6Q2Y9Q3_MCL1-01      VTVKGFGISALKRRESGQYESPEGLKSHTGPDVDTIR-------------
A0A3P8Y1W8_MCL1-05      DLGNGTADTPVRPT---KLEVNMTKPNVLDSRLSDLA-------------
A0A3P8Y1W8_MCL1-04      DLGNGTADTPVRPT---KLEVNMTKPNVLDSRLSDLA-------------
A0A3P8Y1W8_MCL1-01      VPKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQ
A0A3P8Y1W8_MCL1-03      VPKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQ
A0A3P8Y1W8_MCL1-02      VPKEGHGQIPINEQITLEPELEEALKNATDAEMCDIAAILGMYTLMSNKQ
                                                                          

A0A6Q2YT18_MCL1-01      -----------------MRVFSKSKMSLISQGTGECVDECRNRASLDTET
A0A6Q2XQM7_MCL1-01      -----------------MRVFSKSKMSLISQGTGECVDECRNRASLDTET
A0A6Q2YT18_MCL1-02      -----------------MRVFSKSKMSLISQGTGECVDECRNRASLDTET
A0A6Q2XQM7_MCL1-02      -----------------VYLFSKSKMSLISQGTGECVDECRNRASLDTET
A0A6Q2XXK6_MCL1-01      -----------------ILVFSKQKMSLISQGTGECIYERRNRASLDTET
A0A6Q2Y9Q3_MCL1-01      -----------------ILVFSKQKMSLISQGTGECIYKRRNRASLDTET
A0A3P8Y1W8_MCL1-05      --------------DDSDDSLPCTPL-MVTECSAGLSHCPSGNEVLDNDT
A0A3P8Y1W8_MCL1-04      --------------DDSDDSLPCTPL-MVTECSAGLSHCPSGNEVLDNDT
A0A3P8Y1W8_MCL1-01      YYDALGTTGTIANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTND
A0A3P8Y1W8_MCL1-03      YYDALGTTGTIANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTND
A0A3P8Y1W8_MCL1-02      YYDALGTTGTIANTEGINSVVKPDPFKIFPDEPPNPTNVEETLQQIQTND
                                            .    : :..: .            ::.: 

A0A6Q2YT18_MCL1-01      RQLVKSFLGDFTEHLKPRWNESKALSTMKQVVTKSLDKHRYSYNGMLYRL
A0A6Q2XQM7_MCL1-01      RQLVKSFLGDFTEHLKPRWNESKALSTMKQVVTKSLDKHRYSYNGMLYRL
A0A6Q2YT18_MCL1-02      RQLVKSFLGDFTEHLKPRWNESKALSTMKQVVTKSLDKHRYSYNGMLYRL
A0A6Q2XQM7_MCL1-02      RQLVKSFLGDFTEHLKPRWNESKALSTMKQVVTKSLDKHRYSYNGMLYRL
A0A6Q2XXK6_MCL1-01      RQLVKSFLEEFTGCLKPRCNESKALSTMKRVVTETLDKHRYSYNGMLYTL
A0A6Q2Y9Q3_MCL1-01      RQLVKSFLEEFTGCLKPRCNESKALSTMKRVVTETLDKHRYSYNGMLYTL
A0A3P8Y1W8_MCL1-05      RQLIENLLRDYTGLSQPRWKQNKSLVTMKRVVGDVIAKHTYAYKGMISKL
A0A3P8Y1W8_MCL1-04      RQLIENLLRDYTGLSQPRWKQNKSLVTMKRVVGDVIAKHTYAYKGMISKL
A0A3P8Y1W8_MCL1-01      SSLLEVNLNNIKDIPIPTLKE----------IFEAMKTNTH-----VESL
A0A3P8Y1W8_MCL1-03      SSLLEVNLNNIKDIPIPTLKE----------IFEAMKTNTH-----VESL
A0A3P8Y1W8_MCL1-02      SSLLEVNLNNIKDIPIPTLKE----------IFEAMKTNTH-----VESL
                         .*::  * : .    *  ::          : . : .: :     :  *

A0A6Q2YT18_MCL1-01      SLGDSPGDYVRFVSVIANRLFADGTTNWGRVISLLAFGTVVCRYLKDKGK
A0A6Q2XQM7_MCL1-01      SLGDSPGDYVRFVSVIANRLFADGTTNWGRVVSLLAFGTVVCRYLKDKGK
A0A6Q2YT18_MCL1-02      SLGDSPGDYVRFVSVIANRLFADGTTNWGRVISLLAFGTVVCRYLKDKGK
A0A6Q2XQM7_MCL1-02      SLGDSPGDYVRFVSVIANRLFADGTTNWGRVVSLLAFGTVVCRYLKDKGK
A0A6Q2XXK6_MCL1-01      SLDDSTGHDVGFVGVVANRLFADGVTNWGRVVSLLAFGAAVCRYLKDKGK
A0A6Q2Y9Q3_MCL1-01      SLDDSTGHDVGFVGVVANRLFADGVTNWGRVVSLLAFGAAVCRYLKDKGK
A0A3P8Y1W8_MCL1-05      CLDDQ-GDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGK
A0A3P8Y1W8_MCL1-04      CLDDQ-GDDMGFITSVAKSLFSDGTTNWGRIASLVGFGAVVSQHLKEMGK
A0A3P8Y1W8_MCL1-01      SIAAT-RSNDPVAFAVAEMLQENTTLQSLNIESNFITSEGMTAIVKAMAN
A0A3P8Y1W8_MCL1-03      SIAAT-RSNDPVAFAVAEMLQENTTLQSLNIESNFITSEGMTAIVKAMAN
A0A3P8Y1W8_MCL1-02      SIAAT-RSNDPVAFAVAEMLQENTTLQSLNIESNFITSEGMTAIVKAMAN
                        .:         .   :*: *  : . :  .: * .  .  :   :*  .:

A0A6Q2YT18_MCL1-01      DNCVEAVGQEISMYLLTDQRDWLVKNNSWDGFVEFFRVAE-ESTLRNVLL
A0A6Q2XQM7_MCL1-01      DNCVEAVGQEISMYLLTDQRDWLVKNNSWDGFVEFFRVAE-ESTLRNVLL
A0A6Q2YT18_MCL1-02      DNCVEAVGQEISMYLLTDQRDWLVKNNSWDGFVEFFRVAE-ESTLRNVLL
A0A6Q2XQM7_MCL1-02      DNCVEAVGQEISMYLLTDQRDWLVKNNSWDGFVEFFRVAE-ESTLRNVLL
A0A6Q2XXK6_MCL1-01      ENCVEAVGQEISMHLLTDHKDWLVKNNSWDGFVEFFRVAE-ESTLRNVLV
A0A6Q2Y9Q3_MCL1-01      ENCVEAVGQEISMHLLTDHKDWLVKNNSWDGFVEFFRVAE-ESTLRNVLV
A0A3P8Y1W8_MCL1-05      GNCVELVGQEISTYLLTDQRAWLVKNNAWDGFVEFFHVEDPESSVRNTLM
A0A3P8Y1W8_MCL1-04      GNCVELVGQEISTYLLTDQRAWLVKNNAWDGFVEFFHVEDPESSVRNTLM
A0A3P8Y1W8_MCL1-01      NNTLTEIKIDNQRQKLGDSCE-----------MEIASMLENNSSILKIGY
A0A3P8Y1W8_MCL1-03      NNTLTEIKIDNQRQKLGDSCE-----------MEIASMLENNSSILKIGY
A0A3P8Y1W8_MCL1-02      NNTLTEIKIDNQRQKLGDSCE-----------MEIASMLENNSSILKIGY
                         * :  :  : .   * *              :*:  : : :*:: :   

A0A6Q2YT18_MCL1-01      TFDVVYTLWIRFS---------------------------
A0A6Q2XQM7_MCL1-01      TFAGFGAALAMLKMVG------YQ----------------
A0A6Q2YT18_MCL1-02      TFAGFRAALAMLKMYVVTGKNLYM----------------
A0A6Q2XQM7_MCL1-02      TFAGFGAALAMLKMYVVTGKSLYM----------------
A0A6Q2XXK6_MCL1-01      TFAAFAGFWAALVMLDM-----------------------
A0A6Q2Y9Q3_MCL1-01      TFAAFAVSMVHYIRAVY-----------------------
A0A3P8Y1W8_MCL1-05      AFAGVAGIGATLALLIR-----------------------
A0A3P8Y1W8_MCL1-04      AFAGVAGIGATLALLIRQSPAHPWGCEACLCDPS------
A0A3P8Y1W8_MCL1-01      HFTQQGPRARAAIAITRNNDLI------------RQQRLR
A0A3P8Y1W8_MCL1-03      HFTQQGPRARAAIAITRNNDLSEHL---------------
A0A3P8Y1W8_MCL1-02      HFTQQGPRARAAIAITRNNDLIVYGFPTCDDLSHRRFSFT
                         *                                      

© 1998-2022Legal notice