Dataset for protein Bfl1 of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mtdc----------------------------------------------------------------------mekqfe
----efgyihmlaqdylkyvlqipqpgsgpsktsrvlqdiafsvqneveknlkpcldnfhvvsidaartifnqv------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 *******************************************                    
dgiinwgrimtifafegILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWviahsqyqkskrisiflsmq
-----------------                                           --------------------
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :. *: .:: :*..: :::::.    : : *  :                              
deieteeiirdifqqgktcFipryqfnSnhmdmvklaspeeilslpKtswnihqpgeeevreealstggld---------
----------------eng vkkfepk gwltflevtgkmceilfl qyy---------------------lilmpglgf
                                                                   aawr         

       250       260       270       280       290       300    
....:....|....:....|....:....|....:....|....:....|....:....|....
                                                                
----------------------------------------------------------------
dkhgnrlgrgkgyydtylkrclqhqevkpytlalafkeqicvqvpvdendmkvdevlyedssas
                                                                
© 1998-2020Legal notice