Dataset for protein Bfl1 of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mtdc----------------------------------------------------------------------mekqfe
----efgyihmlaqdylkyvlqipqpgsgpsktsrvlqdiafsvqneveknlkpcldnfhvvsidaartifnqv------
 aaa                                                                            

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            .      :.  * :*:                  : .: *.:**.     .                 
dgiinwgrimtifafegilikklLpeRiapdvdtykeisyfvaefitkntgEwiRQn---ggwviahsqyqkskrisifl
-----------av------lrae kq lr-----------------amsae rl  srlltqk-----------------
            lsgakrr                                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   :. *: .:: :*..: :::::.    : : *  :                           
smqdeieteeiirdifqqgktcFipryqfnSnhmdmvklaspeeilslpKtswnihqpgeeevreealstggldlilmpg
-------------------eng vkkfepk gwltflevtgkmceilfl qyy---------------------------
                                                                      aawr      

       250       260       270       280       290       300       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
                                                                   
lgfdkhgnrlgrgkgyydtylkrclqhqevkpytlalafkeqicvqvpvdendmkvdevlyedssas
-------------------------------------------------------------------
                                                                   
© 1998-2022Legal notice