Dataset for protein Bfl1 of organism Equus caballus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A5F5PK00_BCL2A1-04 BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus GN=BCL2A1 (length=244 residues).
MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFE
DGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWHFLLIAWCCPDLLLPFPSLS
QVETVCESQLGETGFPTDGVGLQQPGTQILLQTLCHSPSRLECELDLVTCFQRRECRKGKQSNSAVEKPGKYYFGKVIKV
NIIS
>gnl|bcl2dbpro|A0A5F5PK00_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus GN=BCL2A1 (length=171 residues).
MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFE
DGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWAFLCNDRAYGTTCPSQSPFL
PETLFSNSAFL
>gnl|bcl2dbpro|A0A5F5PK00_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus GN=BCL2A1 (length=174 residues).
MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFE
DGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWPRVHWLGSWVRTYTPLIKPC
CGGISRRRTRRTCN
>gnl|bcl2dbpro|A0A5F5PK00_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Equus caballus GN=BCL2A1 (length=174 residues).
MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFE
DGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWENGFVKKFEPKSGWLTFLEV
TGKMCEILFLKQYY
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice