Dataset for protein Bfl1 of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A5F5PK00_BCL2A1-      MTDC----------------------------------------------
A0A5F5PK00_BCL2A1-      MAAA----------------------------------------------
A0A5F5PK00_BCL2A1-      MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEK
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A5F5PK00_BCL2A1-      MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEK
                                                                          

A0A5F5PK00_BCL2A1-      -----------------------------------------IL------I
A0A5F5PK00_BCL2A1-      -----------------------------------------AVSGAKRRL
A0A5F5PK00_BCL2A1-      NLKPCLDNFHVVSIDAARTIFNQVMEKQFEDGIINWGRIMTIFAFEGILI
A0A5F5PK00_BCL2A1-      ------------------------MEKQFEDGIINWGRIMTIFAFEGILI
A0A5F5PK00_BCL2A1-      NLKPCLDNFHVVSIDAARTIFNQVMEKQFEDGIINWGRIMTIFAFEGILI
                                                                  .      :

A0A5F5PK00_BCL2A1-      KKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQN---GGWVIAHSQY
A0A5F5PK00_BCL2A1-      RAELKQRLR-----------------AMSAEERLRQSRLLTQKVIAHSQY
A0A5F5PK00_BCL2A1-      KKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQN---GGW-------
A0A5F5PK00_BCL2A1-      KKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQN---GGWVIAHSQY
A0A5F5PK00_BCL2A1-      KKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQN---GGWVIAHSQY
                        .  * :*:                  : .: *.:**.     .       

A0A5F5PK00_BCL2A1-      QKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNHMDMVKLA
A0A5F5PK00_BCL2A1-      QKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNHMDMVKLA
A0A5F5PK00_BCL2A1-      -----------------------------ENGFVKKFEPKSGWLTFLEVT
A0A5F5PK00_BCL2A1-      QKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNHMDMVKLA
A0A5F5PK00_BCL2A1-      QKSKRISIFLSMQDEIETEEIIRDIFQQGKTCFIPRYQFNSNHMDMVKLA
                                                     :. *: .:: :*..: :::::

A0A5F5PK00_BCL2A1-      SPEEILSLPKTSWNIHQPGEEEVREEALSTGGLDLILMPGLGFDKHGNRL
A0A5F5PK00_BCL2A1-      SPEEILSLPKTSWNIHQPGEEEVREEALSTGGLDLILMPGLGFDKHGNRL
A0A5F5PK00_BCL2A1-      GKMCEILFLKQYY-------------------------------------
A0A5F5PK00_BCL2A1-      SPEEILSLPKTSWNIHQPGEEEVREEALSTGGLDLILMPGLGFDKHGNRL
A0A5F5PK00_BCL2A1-      SPEEILSLPKTSWNIHQPGEEEVREEALSTAAWR----------------
                        .    : : *  :                                     

A0A5F5PK00_BCL2A1-      GRGKGYYDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVL
A0A5F5PK00_BCL2A1-      GRGKGYYDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVL
A0A5F5PK00_BCL2A1-      --------------------------------------------------
A0A5F5PK00_BCL2A1-      GRGKGYYDTYLKRCLQHQEVKPYTLALAFKEQICVQVPVDENDMKVDEVL
A0A5F5PK00_BCL2A1-      --------------------------------------------------
                                                                          

A0A5F5PK00_BCL2A1-      YEDSSAS
A0A5F5PK00_BCL2A1-      YEDSSAS
A0A5F5PK00_BCL2A1-      -------
A0A5F5PK00_BCL2A1-      YEDSSAS
A0A5F5PK00_BCL2A1-      -------
                               

© 1998-2022Legal notice