Dataset for protein BCL-2-like of organism Electrophorus electricus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                       . .               :      .    .                    .     
 amenmkmineldek       lne fglnm  tmhieiel ggqide ge gedafecea sldrffegqslegeeepp
    mldh  a   c       i d   k g  claa d e fcae    d a   a  a         caaaa d aei

        90       100       110       120       130       140       150       160
   .    .                                   .:    ...   :   :  :  :*::         .
splpqltgtrps-yysrlrrellgyfyrtytglphrrtklsllpvmtesggsvvlrhrpdfnelvsk qmesqseaqqsv
ina lee  gfrsglgghe                     kakga kdaaddfiel ql  kd iq  ni pigd meri
h   aa    aa dgdaea                       he          c  ei    k      a   l   

       170       180       190       200       210       220       230       240
 :* ..:* .* .****: .:. **. :*    :.  .  *  :.  :: **    . *: :: .*: * :::       
ss mdsv rs mt    vvgfve  ssl kylnnsergpq rrighrisv  nsplrp ilnqgs eh mdlygrqkdsv
ea i  l    k      ia l   gm  eshk   qdal gn  ge  e  lnhkqe    a  a k i  kdaaae
                          a            c  l         dgdi d           a          

       250       260       270   
   .  *            .*.  *  :  .  
nsrdwp kltwlsltmttvv lvv lyflrkrl
hre  ikkvf agillat iti il fm   
f      f       a     f         
© 1998-2023Legal notice