Dataset for protein BCL-2-like of organism Electrophorus electricus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W4F1X6_MCL1-01      MSMTTMKRTTAIGLLCNGAQHGVKDSFVLGVRPTMAAEDELDGCAEDTDG
A0A4W4H9I6_MCL1-01      -------MINPQDMCY------SKESSGPGMRPVLSLGITSDKRVIGEGS
A0A4W4F7Z4_BCL2-01      MANENLDHNRNIVEKY------LNHKLSKNGY-------MWEFHSRETDP
A0A4W4GHX3_BCL2L1-      ----MSYYNRELVMYY------IRYKLSQRNYPCSHIGLTEDMGQTEGGP
                                               . .               :      . 

A0A4W4F1X6_MCL1-01      WPLKPARHGRGLTLDTRFPQSSNADGSLPTSPDSQETLPDFRSDLDAETR
A0A4W4H9I6_MCL1-01      LPNSPESDCEELSVVRFTEGRTLENDTREIINDSLLELTGRSNYYSRHR-
A0A4W4F7Z4_BCL2-01      DPASNGFDAPE------RRCQASTDEEETVHRAPRAPLPDP------YA-
A0A4W4GHX3_BCL2L1-      E-GEDGAEAAA------TPTAVANGSTASPTRLPASPGPRAANGGGGLE-
                           .                    .        .    .           

A0A4W4F1X6_MCL1-01      ELLGYFYRTYTGLPHRRTKLSALPTLTRVVGDVICKHRIAYNGMVQKLQM
A0A4W4H9I6_MCL1-01      --------------------KVVGTMKRVVNSLVEKHELAYKGMIVKLNL
A0A4W4F7Z4_BCL2-01      --------------------ALHRVLREAGDELERLYQPDFAEMSKQLHL
A0A4W4GHX3_BCL2L1-      --------------------AVKEALRDSANEFELRYSRAFSDLSSQLHI
                                                .:    ...   :   :  :  :*::

A0A4W4F1X6_MCL1-01      EEQSDDLEVVSTVAKSMFSDGMTNWGRVASLVAFGAVLCESLKESGRDHC
A0A4W4H9I6_MCL1-01      EERGEDMRVITTVAKEMFSDGKTNWGRIASLLAFGSMVCKYHNEKGQGHR
A0A4W4F7Z4_BCL2-01      TSI-TAQRRFTAVIDELFRDG-VNWGRIIAFFEFGASVCVECVNKEMSAQ
A0A4W4GHX3_BCL2L1-      TPA-TAYQSFESVMDEVFRSG-VNWGRIVGLFAFGGALCVECVEKEMSPL
                                 . :* ..:* .* .****: .:. **. :*    :.  .  

A0A4W4F1X6_MCL1-01      VDTVAHRISSYLTTYQHEWLLNNKSWDGFKEFF-------QVEDPESVVR
A0A4W4H9I6_MCL1-01      VRLVGEEISSYLLSDKRDWLLKNKAWDGFVDFF-------HVSDPESKLR
A0A4W4F7Z4_BCL2-01      VDNIAGWMTEYLNGPLHSWIQENGGWDAFMELYGRQKDSVFSSSWPSIVT
A0A4W4GHX3_BCL2L1-      VGRIAEWMTVYLDNHIQPWIQEQGGWEHFAEIFGKDAAAENRRSQESFKK
                        *  :.  :: **    . *: :: .*: * :::          .  *   

A0A4W4F1X6_MCL1-01      NALMAVAGFAGLGAGLALLMR--
A0A4W4H9I6_MCL1-01      NALMTIATVAGIGAGIAFFRR--
A0A4W4F7Z4_BCL2-01      VFSLAALGAVGFTIGAYLAQK--
A0A4W4GHX3_BCL2L1-      WLLAGMTLFTGVVVGSLFAQKRL
                                 .*.  *  :  .  

© 1998-2020Legal notice