Dataset for protein BCL-2-like of organism Electrophorus electricus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A4W4F1X6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Electrophorus electricus GN=MCL-1 (length=264 residues).
MSMTTMKRTTAIGLLCNGAQHGVKDSFVLGVRPTMAAEDELDGCAEDTDGWPLKPARHGRGLTLDTRFPQSSNADGSLPT
SPDSQETLPDFRSDLDAETRELLGYFYRTYTGLPHRRTKLSALPTLTRVVGDVICKHRIAYNGMVQKLQMEEQSDDLEVV
STVAKSMFSDGMTNWGRVASLVAFGAVLCESLKESGRDHCVDTVAHRISSYLTTYQHEWLLNNKSWDGFKEFFQVEDPES
VVRNALMAVAGFAGLGAGLALLMR
>gnl|bcl2dbpro|A0A4W4F7Z4_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Electrophorus electricus GN=BCL-2 (length=223 residues).
MANENLDHNRNIVEKYLNHKLSKNGYMWEFHSRETDPDPASNGFDAPERRCQASTDEEETVHRAPRAPLPDPYAALHRVL
REAGDELERLYQPDFAEMSKQLHLTSITAQRRFTAVIDELFRDGVNWGRIIAFFEFGASVCVECVNKEMSAQVDNIAGWM
TEYLNGPLHSWIQENGGWDAFMELYGRQKDSVFSSSWPSIVTVFSLAALGAVGFTIGAYLAQK
>gnl|bcl2dbpro|A0A4W4GHX3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Electrophorus electricus GN=BCL2L1 (length=233 residues).
MSYYNRELVMYYIRYKLSQRNYPCSHIGLTEDMGQTEGGPEGEDGAEAAATPTAVANGSTASPTRLPASPGPRAANGGGG
LEAVKEALRDSANEFELRYSRAFSDLSSQLHITPATAYQSFESVMDEVFRSGVNWGRIVGLFAFGGALCVECVEKEMSPL
VGRIAEWMTVYLDNHIQPWIQEQGGWEHFAEIFGKDAAAENRRSQESFKKWLLAGMTLFTGVVVGSLFAQKRL
>gnl|bcl2dbpro|A0A4W4H9I6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Electrophorus electricus GN=MCL-1 (length=230 residues).
MINPQDMCYSKESSGPGMRPVLSLGITSDKRVIGEGSLPNSPESDCEELSVVRFTEGRTLENDTREIINDSLLELTGRSN
YYSRHRKVVGTMKRVVNSLVEKHELAYKGMIVKLNLEERGEDMRVITTVAKEMFSDGKTNWGRIASLLAFGSMVCKYHNE
KGQGHRVRLVGEEISSYLLSDKRDWLLKNKAWDGFVDFFHVSDPESKLRNALMTIATVAGIGAGIAFFRR
© 1998-2020Legal notice