Dataset for protein BCL-2-like of organism Delphinapterus leucas

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                         :. .   
mtdsefgyih--------------------------------------------------------------mLaqdylk
----------rsvrglnlyrlramsaprsgydnrapgrrllaagkeatagrevgggeageviggsagpsppaeivvkfvt
 aatmvsskrnaliaelkrcggmlltgetsssts                                      t  p vrs
    a  lak             ghgedrlrqs                                       l  m air
                       aa  amaqga                                       a  a  fh
                              p                                                g
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
yvlqip--------qpgsgpskts--------------------------------------------------------
vkrsqkgyswsqfsdvqenrttsptaarspmitpsrrnstpswsrtsvppvqtapghsssgparepvpmrpsvlpllelv
hsqysrskri i lvmddeigeg-gptpllgffstqpggp epmlsdssdpnmsteeplrldepsvlgk           
 a r    e     sgaaageveaeg eadfea  aia n aehea p aaig  aaead c l  i             
   p          ic    d a a                                                       
               a    a                                                           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 :.             
---------------------------------------------------------------rvlqdvafsvqnevekn
geasnspgkdgslpstpppaeeeedelyrqsleiisrylreqatgtkdakplggsgaasrkaletvkqalrqagdnfstr
                                                               ppihrtmqggktdhira
                                                               di rligde  rc  p 
                                                               aa    f a      l 
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .     :                                .  . * :::                  * . :       
lkpcldnid----------vvsidtartifnqVmereFedGivNWGRiVt---------------ifaFegilikkllgg
yrrtfsdltmvklaspsqlhstpgsvyqr-ttsvvelrrgav-st sllasttsepvemrvcqvffis gaamcvesv--
fqgqsrkms       eeislnekdswsshsr snhv se pt      s               yhv t vvkrvg-nk
  fm nh a       a  ikl f  qnl qp ed   q                        l e   l aah idr
   d ae             i     kg  e                                        f        
   a                          a                                                 
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        :      .:     *                                         
riapdvdtykeisyfvaef-----itkntgeWirqngGWvfthsqyqks-----f---------e--ikdifqqgktcfi
em--l-s-----alwmttynflsvlnrhladrvvssrv --f--l-g--krisi-lsmqdeiet-eia-------rer--
--sv-e-cierv-estvdw      vttvrt lqkqp  dt-ve-w-sn   dg vdffhvedl gg-rresrks--g v
ksqnq g   qlqa irav      rdrkhr  hfc   klgtrn cpg                  vmnvlfrltr- n
  i       p              ea  ep   e    ae qa   nc                  mlesa   qpl f
  e       n                       d     a      d                    aa     en  d
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         :                                                                      
pryqfqsnhldmvklasp-eeisslpktsw--------------------------------------------------
------r-fmtg-vvvgkcvtlgayls-k-nihqpsevevreealstgsldliflssttsepvemrvcqvfysssypppp
vswtsv-w- afamttpavqlvlyqfrs-ytg               ahr    mplvgfskhgn l   eshiftglmk
knllqtqtw sllippavligralfmprys                  g       glaadg                  
flfeplkrv  a gal gic   c igq                                                    
 k a k gl    e    ga      ap                                                    
       a     a             h                                                    

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rvtylwtrtwnltsvlrahvarrvvycpvwklgqrnwcsstqtrtglplvrssqksvvrpfvlllqtsrtvysqvpvllq
 pgicqpek eflp      gdpkgsynsy      l  c        vmsclnsqttshytkktpnqgqlcllpspken
                      g ef da                    k  af cdr f l a afkefiaaia ldce
                                                                                
                                                                                
                                                                                

       570     
....:....|....:
               
---------------
ertvqmvsystssas
dmktdespwgng   
 fgladplkedc   
               
               
               
© 1998-2020Legal notice