Dataset for protein BCL-2-like of organism Delphinapterus leucas

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mtdsefgyih--------------------------------------------------------------mlaqdylk
----------naviglnlycggaglgpdsgsgasapgrrllaagkeatagrevgggeagevmgtsaspsptr--------
    m  lkr                                                   iagp gapdpat vp fvr
                                                                        a  a arg
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
yvlqi------pqpgsgpskts----------------------------------------------------------
-----kgyvcg-----------tparllffaptrrasppeemessvsdaimspeeeldgcepeplgkrpsvlpllelvge
vkrrs      aigae  dvdp                                                          
 a pq       g     aa a                                                          
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------rvlqdvafsvqneveknlk
asnspgkdgslpstpppaeeeedelyrqsleiisrylreqatgtkdakplggsgaasrkal-------------------
                                                             et rrmmrtavsshktsfr
                                                                hqagdg grnf rr q
                                                                    aa  d a  a  
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     ..                                                         
pcldnidv---vsidtartifnqvmerefedgivnwgrivtifafegilikkllggriapdvdtykeisyfvaefitknt
--------qlh---a--tsr-srelvvky---------------------------------------------------
rtfsrllr   mts-svqqyslsdqvvsg vt    l aliv gafvcahsvnkksinqesqvqplaewmvdylvttl
gm rkrai   knpggrmlqq   iaml q   p       f s   a a e    eme l gcie    sitav errk
ae kd  a   alh eekgld     hd                                                    
            ae d          e                                                     
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gewirqnggw-fthsqyqkskrisiflsmqdeiete--------------------------------------------
----------v-------------------------pggtpspmitssqpnstpswsrtssppvqtatghssslparsvv
rd lvssr   lsykls rgysw q sdvgenrtes eaaeadgefp aiggn aphladp apng paapargd lepi
a   hkq    ih        e      ad aga a                                            
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--eiikdifqqgktcfipryqfqsnhmdmvklaspeeisslpktswnihqpsevevreealstgsl----ls--------
pm---------------------fgflt-------s----------------v-------v---rirnvl-asttsepve
  pvvhqtlreagdg vrkfrrkdswvsfyhvtgl-qlhrtrggayqsfetv-rtlfrdg-nwag-dlifv-lvgvsghg
  aa  la    ene sl  epdaeetallgdgd   arl  f nrgr aq  n  ltg  al -r    mpglafdk  
              d ek    a ad   fe ea     i  e       a  e          h       fa aa   
                                                                a               
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-r-c---------------------------------------------------------------c------------
m-v-qvfyhsftglmrvvsvnremsvlvsrialwtrtynlpsvlrahvarwvvfnpvwklgvrnygs-vmrssfkstprf
nklgyllffesgyvwkrlgsdk  qp  dn  stmtswtfllpsnrtlhtriqecgg dtfqelwcpsltsqyy qvrvs
agiarikryydcnslcneqi            qdvsrtsyapapspqyep   d     a      nnqpkkwr krend
    egipv  a ak c c             a qapig    fkenk                    mlehfl gq l 
     aeg                            e        d i                    aaae    l   
      d                                                                         

       570       580       590  
....:....|....:....|....:....|..
                                
--------------------------------
fvlltqtqrlleeitppkcvtrglqmppkstg
ntvysvlswfyaaspvagvqelnayfss    
gnswlsdrv  tlmstsdsswv sllgr    
efdmklakl  sgllaga ilg cf ah    
d      ea   df                  
             a                  
© 1998-2022Legal notice