Dataset for protein BCL-2-like of organism Delphinapterus leucas

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2Y9MRT2_MCL1-01      ----MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAG
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIH----------------------------------------
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIH----------------------------------------
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIH----------------------------------------
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIH----------------------------------------
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIH----------------------------------------
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIH----------------------------------------
A0A2Y9LQ01_BCL2L2-      -----------------------MATPASAPDTR----------------
A0A2Y9LKR0_BCL2A1-      MAATAVSSAKRSLRAELKRRLRALSAEERLRQSR----------------
A0A2Y9P9P5_BCL2-01      ----------------------MAHAGRTGYDNR----------------
A0A2Y9PZ68_BCL2L1-      ----------------------------MSQSNR----------------
                                                                          

A0A2Y9MRT2_MCL1-01      REVGGGEAGEVIGGSAGPSPPATLAPDARRVARPSP--------IGAEGP
A0A2Y9LKR0_BCL2A1-      ----------------------MLAQDYLKYVLQIP--------QPGSGP
A0A2Y9LKR0_BCL2A1-      ----------------------MLAQDYLKYVLQIP--------QPGSGP
A0A2Y9LKR0_BCL2A1-      ----------------------MLAQDYLKYVLQIP--------QPGSGP
A0A2Y9LKR0_BCL2A1-      ----------------------MLAQDYLKYVLQIP--------QPGSGP
A0A2Y9LKR0_BCL2A1-      ----------------------MLAQDYLKYVLQIP--------QPGSGP
A0A2Y9LKR0_BCL2A1-      ----------------------MLAQDYLKYVLQIP--------QPGSGP
A0A2Y9LQ01_BCL2L2-      ----------------------ALVADFVGYKLRQKGY------VCGAGP
A0A2Y9LKR0_BCL2A1-      ----------------------LLAQKVFTHSQYQKSKRISIFLSMQDEI
A0A2Y9P9P5_BCL2-01      ----------------------EIVMKYIHYKLSQRGYEW----DAGDAG
A0A2Y9PZ68_BCL2L1-      ----------------------ELVVDFLSYKLSQKGYSWSQFSDVDENR
                                               :. .                       

A0A2Y9MRT2_MCL1-01      DVTATPARLLFFAPTRRASPPEEMESSVSDAIMSPEEELDGCEPEPLGKR
A0A2Y9LKR0_BCL2A1-      SKTS----------------------------------------------
A0A2Y9LKR0_BCL2A1-      SKTS----------------------------------------------
A0A2Y9LKR0_BCL2A1-      SKTS----------------------------------------------
A0A2Y9LKR0_BCL2A1-      SKTS----------------------------------------------
A0A2Y9LKR0_BCL2A1-      SKTS----------------------------------------------
A0A2Y9LKR0_BCL2A1-      SKTS----------------------------------------------
A0A2Y9LQ01_BCL2L2-      GEGPAA--------------------------------------------
A0A2Y9LKR0_BCL2A1-      ETE-----------------------------------------------
A0A2Y9P9P5_BCL2-01      ATSPGAAPAPGIFSSQPGSTPAPSRTSPPPPQTAPAAPARGPALSPVP--
A0A2Y9PZ68_BCL2L1-      TEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPM-
                                                                          

A0A2Y9MRT2_MCL1-01      PSVLPLLELVGEASNSPGKDGSLPSTPPPAEEEEDELYRQSLEIISRYLR
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LQ01_BCL2L2-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9P9P5_BCL2-01      --------------------------------------------------
A0A2Y9PZ68_BCL2L1-      --------------------------------------------------
                                                                          

A0A2Y9MRT2_MCL1-01      EQATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLD-
A0A2Y9LKR0_BCL2A1-      -----------------------RVLQDVAFSVQNEVEKNLKPCLDNID-
A0A2Y9LKR0_BCL2A1-      -----------------------RVLQDVAFSVQNEVEKNLKPCLDNID-
A0A2Y9LKR0_BCL2A1-      -----------------------RVLQDVAFSVQNEVEKNLKPCLDNID-
A0A2Y9LKR0_BCL2A1-      -----------------------RVLQDVAFSVQNEVEKNLKPCLDNID-
A0A2Y9LKR0_BCL2A1-      -----------------------RVLQDVAFSVQNEVEKNLKPCLDNID-
A0A2Y9LKR0_BCL2A1-      -----------------------RVLQDVAFSVQNEVEKNLKPCLDNID-
A0A2Y9LQ01_BCL2L2-      -----------------------DPLHQAMRAAGDEFETRFRRTFSDLA-
A0A2Y9LKR0_BCL2A1-      -----------------------EIIKDIFQQGKTCFIPRYQFQSNHMDM
A0A2Y9P9P5_BCL2-01      -----------------------PVVHLTLRQAGDDFSRRYRRDFAEMS-
A0A2Y9PZ68_BCL2L1-      -----------------------AAVKQALREAGDEFELRYRRAFSDLT-
                                                 :.              .     :  

A0A2Y9MRT2_MCL1-01      ---------IKNEDDVKSL-SRVMVHVFSDGVTNWGRIVT----------
A0A2Y9LKR0_BCL2A1-      ---------VVSIDTARTIFNQVMEREFEDGIVNWGRIVT----------
A0A2Y9LKR0_BCL2A1-      ---------VVSIDTARTIFNQVMEREFEDGIVNWGRIVT----------
A0A2Y9LKR0_BCL2A1-      ---------VVSIDTARTIFNQVMEREFEDGIVNWGRIVT----------
A0A2Y9LKR0_BCL2A1-      ---------VVSIDTARTIFNQVMEREFEDGIVNWGRIVT----------
A0A2Y9LKR0_BCL2A1-      ---------VVSIDTARTIFNQVMEREFEDGIVNWGRIVT----------
A0A2Y9LKR0_BCL2A1-      ---------VVSIDTARTIFNQVMEREFEDGIVNWGRIVT----------
A0A2Y9LQ01_BCL2L2-      ------AQLHVTPGSAQQRFTQVSDELFQGGP-NWGRLVA----------
A0A2Y9LKR0_BCL2A1-      VKLASPEEISSLPKTSWNIHQPSEVEVREEAL-STGSLLSSTTSEPVEMR
A0A2Y9P9P5_BCL2-01      ------SQLHLTPFTARGRFATVVEELFRDGV-NWGRIVA----------
A0A2Y9PZ68_BCL2L1-      ------SQLHITPGTAYQSFEQVVNELFRDGV-NWGRIVA----------
                                                      .  . * :::          

A0A2Y9MRT2_MCL1-01      -----LISFGAFVAKHL---KSINQESCIEPLAESITDV-----LVRTKR
A0A2Y9LKR0_BCL2A1-      -----IFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEF-----ITKNTG
A0A2Y9LKR0_BCL2A1-      -----IFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEF-----ITKNTG
A0A2Y9LKR0_BCL2A1-      -----IFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEF-----ITKNTG
A0A2Y9LKR0_BCL2A1-      -----IFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEF-----ITKNTG
A0A2Y9LKR0_BCL2A1-      -----IFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEF-----ITKNTG
A0A2Y9LKR0_BCL2A1-      -----IFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEF-----ITKNTG
A0A2Y9LQ01_BCL2L2-      -----FFVFGAALCAESVNKEMEPLVG---QVQEWMVAY-----LETRLA
A0A2Y9LKR0_BCL2A1-      VCQVFYHSFTGLMKRVGI---------------LWTRTWNFLSVLRAHVA
A0A2Y9P9P5_BCL2-01      -----FFEFGGVMCVESVNREMSPLVD---NIALWMTEY-----LNRHLH
A0A2Y9PZ68_BCL2L1-      -----FFSFGGALCVESVDKEMQVLVS---RIAAWMATY-----LNDHLE
                                * . :                               :     

A0A2Y9MRT2_MCL1-01      DWLVKQRGW-------------DGFVDFFHVEDLEGGIRNVL--------
A0A2Y9LKR0_BCL2A1-      EWIRQNGGW------------------------------------ENGFV
A0A2Y9LKR0_BCL2A1-      EWIRQNGGWVFTHSQYQKSKRISIFLSMQDEIETEEIIKDIFQQGKTCFI
A0A2Y9LKR0_BCL2A1-      EWIRQNGGWVFTHSQYQKSKRISIFLSMQDEIETEEIIKDIFQQGKTCFI
A0A2Y9LKR0_BCL2A1-      EWIRQNGGWVFTHSQYQKSKRISIFLSMQDEIETEEIIKDIFQQGKTCFI
A0A2Y9LKR0_BCL2A1-      EWIRQNGGWVFTHSQYQKSKRISIFLSMQDEIETEEIIKDIFQQGKTCFI
A0A2Y9LKR0_BCL2A1-      EWIRQNGGWVFTHSQYQKSKRISIFLSMQDEIETEEIIKDIFQQGKTCFI
A0A2Y9LQ01_BCL2L2-      DWIHSSGGWAEFTALYGDG------------------ALEEARRLREG--
A0A2Y9LKR0_BCL2A1-      RRVVFCPVWKLGQRNWCSC------------------VMRSSFKSTRRFF
A0A2Y9P9P5_BCL2-01      TWIQDNGGWDAFVELYGPS------------------M-------RPLFD
A0A2Y9PZ68_BCL2L1-      PWIQENGGWDTFVELYGNN------------------AAAESRKGQERFN
                         .:     *                                         

A0A2Y9MRT2_MCL1-01      ---------LAFAGVAGVGAGLAYLIR-----------------------
A0A2Y9LKR0_BCL2A1-      KKFEPKSGWLTFLEVTGKICEILCLLKQYY--------------------
A0A2Y9LKR0_BCL2A1-      PRYQFQSNHMDMVKLASP-EEISSLPKTSWNIHQPSEVEVREEALSTAHR
A0A2Y9LKR0_BCL2A1-      PRYQFQSNHMDMVKLASP-EEISSLPKTSWNIHQPSEVEVREEALSTGSL
A0A2Y9LKR0_BCL2A1-      PRYQFQSNHMDMVKLASP-EEISSLPKTSWNIHQPSEVEVREEALSTGGL
A0A2Y9LKR0_BCL2A1-      PRYQFQSNHMDMVKLASP-EEISSLPKTSWNIHQPSEVEVREEALSTGSL
A0A2Y9LKR0_BCL2A1-      PRYQFQSNHMDMVKLASP-EEISSLPKTSWNIHQPSEVEVREEALSTGSL
A0A2Y9LQ01_BCL2L2-      -NWASVRTVLTGAVALGALVTVGAFFASK---------------------
A0A2Y9LKR0_BCL2A1-      VLLTQTQRFLAA-IPPPKCQERGLQMPPKSTG------------------
A0A2Y9P9P5_BCL2-01      FSWLSLKALLSL-ALVGACITLGAYLGHK---------------------
A0A2Y9PZ68_BCL2L1-      ------RWFLTG-MTVAGVVLLGSLFSRK---------------------
                                 :                                        

A0A2Y9MRT2_MCL1-01      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      ----LSLVAASG--------------------------------------
A0A2Y9LKR0_BCL2A1-      ----LSSTTSEPVEMRVCQVESSISYPPPPRPTYCQPEKWELTP------
A0A2Y9LKR0_BCL2A1-      DLIFMPGLGFDKHGNRL---------------------------------
A0A2Y9LKR0_BCL2A1-      ----LSSTTSEPVEMRVCQ-------------------------------
A0A2Y9LKR0_BCL2A1-      ----LSSTTSEPVEMRVCQVFYHSFTGLMKRVGILWTRTWNFLSVLRAHV
A0A2Y9LQ01_BCL2L2-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9P9P5_BCL2-01      --------------------------------------------------
A0A2Y9PZ68_BCL2L1-      --------------------------------------------------
                                                                          

A0A2Y9MRT2_MCL1-01      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      GRGKGYYDAY------------------LKRCLQSQDVRPYTLALAFKEQ
A0A2Y9LKR0_BCL2A1-      ADPVESCNSW----RNLCSSTQTRTGLPLVSSANKCVTSHFLKKLPNSGT
A0A2Y9LKR0_BCL2A1-      ARRVVFCPVWKLGQRNWCSC--------VMRSSFKSTRRFFVLLTQTQRF
A0A2Y9LQ01_BCL2L2-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9P9P5_BCL2-01      --------------------------------------------------
A0A2Y9PZ68_BCL2L1-      --------------------------------------------------
                                                                          

A0A2Y9MRT2_MCL1-01      -------------------------
A0A2Y9LKR0_BCL2A1-      -------------------------
A0A2Y9LKR0_BCL2A1-      -------------------------
A0A2Y9LKR0_BCL2A1-      -------------------------
A0A2Y9LKR0_BCL2A1-      ICLQVPVDENDMKVDEVLYEDSSAS
A0A2Y9LKR0_BCL2A1-      VYSLASLLLEEFTTADSSWGNC---
A0A2Y9LKR0_BCL2A1-      LAAIPPPKCQERGLQMPPKSTG---
A0A2Y9LQ01_BCL2L2-      -------------------------
A0A2Y9LKR0_BCL2A1-      -------------------------
A0A2Y9P9P5_BCL2-01      -------------------------
A0A2Y9PZ68_BCL2L1-      -------------------------
                                                 

© 1998-2020Legal notice