Dataset for protein BCL-2-like of organism Delphinapterus leucas

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=313 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGSLLSSTTSEPVE
MRVCQADPVESCNSWRNLCSSTQTRTGLPLVSSANKCVTSHFLKKLPNSGTVYSLASLLLEEFTTADSSWGNC
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=340 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGSLLSSTTSEPVE
MRVCQVFYHSFTGLMKRVGILWTRTWNFLSVLRAHVARRVVFCPVWKLGQRNWCSCVMRSSFKSTRRFFVLLTQTQRFLA
AIPPPKCQERGLQMPPKSTG
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-07 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=175 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWENGFVKKFEPKSGWLTFLEV
TGKICEILCLLKQYY
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-06 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=238 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTAHRLSLVAASG
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-05 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=304 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGGLDLIFMPGLGF
DKHGNRLGRGKGYYDAYLKRCLQSQDVRPYTLALAFKEQICLQVPVDENDMKVDEVLYEDSSAS
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-04 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=270 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGSLLSSTTSEPVE
MRVCQVESSISYPPPPRPTYCQPEKWELTP
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=239 residues).
MAATAVSSAKRSLRAELKRRLRALSAEERLRQSRLLAQKVFTHSQYQKSKRISIFLSMQDEIETEEIIKDIFQQGKTCFI
PRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGSLLSSTTSEPVEMRVCQVFYHSFTGLMKRVGIL
WTRTWNFLSVLRAHVARRVVFCPVWKLGQRNWCSCVMRSSFKSTRRFFVLLTQTQRFLAAIPPPKCQERGLQMPPKSTG
>gnl|bcl2dbpro|A0A2Y9LQ01_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A2Y9MRT2_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Delphinapterus leucas GN=MCL-1 (length=351 residues).
MFGLKRNAVIGLNLYCGGAGLGPDSGSGASAPGRRLLAAGKEATAGREVGGGEAGEVIGGSAGPSPPATLAPDARRVARP
SPIGAEGPDVTATPARLLFFAPTRRASPPEEMESSVSDAIMSPEEELDGCEPEPLGKRPSVLPLLELVGEASNSPGKDGS
LPSTPPPAEEEEDELYRQSLEIISRYLREQATGTKDAKPLGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN
EDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVDFF
HVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A2Y9P9P5_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL-2 (length=233 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGATSPGAAPAPGIFSSQPGSTPAPSRTSPPPPQTAPAAPARGPAL
SPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREM
SPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A2Y9PZ68_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVDENRTEAPEGTESDMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2020Legal notice