Dataset for protein Bfl1 of organism Delphinapterus leucas

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                :: .:...  *:. *::..*.                           
mtdsefgyihmlaqdylkyvlqipqpgsgpsktsrvlqdvafSvqnEveknLkpcldnidvvsidtartifnqvmerefe
-------------------------------maatavssakr lra lkrr r---------------------------
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          :: * * :  ..**. .:                                                    
dgivnwgrivtifAfEgilikkLLggriapdvdtykeisyfvaefitkntgewirqnggwvfthsqyqkskrisiflsmq
----------als e rlrqsr  aqkv----------------------------------------------------
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :. *: .:: :*..: :::::.   ** .* *  :                             
deieteeiikdifqqgktcFipryqfqSnhmdmvklasp-eEIssLpKtswnihqpsevevreealstgsl----lsstt
----------------eng vkkfepk gwltflevtgkic  lc l qyy--------------------dlif-----
                                                                    ahr    mplvg
                                                                     g       gla
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
sepvemrvcqv-------l--r------r-w-l---------------------------c-------------------
-----------fyhsstg-mr-vgslwt-t-n-lsvlrahvarrvvfcpvwklgqrnwcs-vmrssfkstrrffvvltqt
fskhgn lgrgksyyfyyswknltistvtrytftlasseqk                    ltvpvlenlpnvgtlyyld
adg       aepvidcppppcpqyqqqeptg pp fk ni                     qshfd kdmksde  sea
           dgse an k   c cdp k e a                                              

       330       340     
....:....|....:....|....:
                         
-------------------------
srflaaipppkcqerglqmppkstg
qslseefttadsswgnc        
 la                      
                         
© 1998-2021Legal notice