Dataset for protein Bfl1 of organism Delphinapterus leucas

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                :: .:...  *:. *::..*.                           
mtdsefgyihmlaqdylkyvlqipqpgsgpsktsrvlqdvafSvqnEveknLkpcldnidvvsidtartifnqvmerefe
-------------------------------maatavssakr lra lkrr r---------------------------
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          :: * * :  ..**. .:                                                    
dgivnwgrivtifAfEgilikkLLggriapdvdtykeisyfvaefitkntgewirqnggwvfthsqyqkskrisiflsmq
----------als e rlrqsr  aqkv----------------------------------------------------
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :. *: .:: :*..: :::::.   ** .* *  :                             
deieteeiikdifqqgktcFipryqfqSnhmdmvklasp-eEIssLpKtswnihqpsevevreealstgsl----lsstt
----------------eng vkkfepk gwltflevtgkic  lc l qyy--------------------dlif-----
                                                                    ahr    mplvg
                                                                     g       gla

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
sepvemrvcq----------------------------------------------------------------------
----------vfyhsftglmkrvgilwtrtwnflsvlrahvarrvvfcpvwklgqrnwcsctqtrtglpvmrssfkstrr
fskhgn l   essisypppp ptycqpek eltp      gdpkgyynsy      l  s        lvsclqsqvvs
adg                                        g es da                    k  an cdt 

       330       340       350      
....:....|....:....|....:....|....:.
                                    
------------------------------------
ffvlltqtqrflaaipppkcqerglqmppkstgsas
pytkklpnsgtvysqvsvllndmtvdevsygns   
h l a afkeqiclla ldee fktadslwedc   
© 1998-2020Legal notice