Dataset for protein Bfl1 of organism Delphinapterus leucas

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2Y9LKR0_BCL2A1-      -------------------------------MAATAVSSAKRSLRAELKR
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEK
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEK
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEK
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEK
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEK
A0A2Y9LKR0_BCL2A1-      MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEK
                                                        :: .:...  *:. *::.

A0A2Y9LKR0_BCL2A1-      RLR-------------------------------------ALSAEERLRQ
A0A2Y9LKR0_BCL2A1-      NLKPCLDNIDVVSIDTARTIFNQVMEREFEDGIVNWGRIVTIFAFEGILI
A0A2Y9LKR0_BCL2A1-      NLKPCLDNIDVVSIDTARTIFNQVMEREFEDGIVNWGRIVTIFAFEGILI
A0A2Y9LKR0_BCL2A1-      NLKPCLDNIDVVSIDTARTIFNQVMEREFEDGIVNWGRIVTIFAFEGILI
A0A2Y9LKR0_BCL2A1-      NLKPCLDNIDVVSIDTARTIFNQVMEREFEDGIVNWGRIVTIFAFEGILI
A0A2Y9LKR0_BCL2A1-      NLKPCLDNIDVVSIDTARTIFNQVMEREFEDGIVNWGRIVTIFAFEGILI
A0A2Y9LKR0_BCL2A1-      NLKPCLDNIDVVSIDTARTIFNQVMEREFEDGIVNWGRIVTIFAFEGILI
                        .*.                                     :: * * :  

A0A2Y9LKR0_BCL2A1-      SRLLAQKV---------------------------------FTHSQYQKS
A0A2Y9LKR0_BCL2A1-      KKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGW----------
A0A2Y9LKR0_BCL2A1-      KKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKS
A0A2Y9LKR0_BCL2A1-      KKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKS
A0A2Y9LKR0_BCL2A1-      KKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKS
A0A2Y9LKR0_BCL2A1-      KKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKS
A0A2Y9LKR0_BCL2A1-      KKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKS
                        ..**. .:                                          

A0A2Y9LKR0_BCL2A1-      KRISIFLSMQDEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASP-
A0A2Y9LKR0_BCL2A1-      --------------------------ENGFVKKFEPKSGWLTFLEVTGKI
A0A2Y9LKR0_BCL2A1-      KRISIFLSMQDEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASP-
A0A2Y9LKR0_BCL2A1-      KRISIFLSMQDEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASP-
A0A2Y9LKR0_BCL2A1-      KRISIFLSMQDEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASP-
A0A2Y9LKR0_BCL2A1-      KRISIFLSMQDEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASP-
A0A2Y9LKR0_BCL2A1-      KRISIFLSMQDEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASP-
                                                  :. *: .:: :*..: :::::.  

A0A2Y9LKR0_BCL2A1-      EEISSLPKTSWNIHQPSEVEVREEALSTGSL----LSSTTSEPVEMRVCQ
A0A2Y9LKR0_BCL2A1-      CEILCLLKQYY---------------------------------------
A0A2Y9LKR0_BCL2A1-      EEISSLPKTSWNIHQPSEVEVREEALSTGSL----LSSTTSEPVEMRVCQ
A0A2Y9LKR0_BCL2A1-      EEISSLPKTSWNIHQPSEVEVREEALSTGGLDLIFMPGLGFDKHGNRLGR
A0A2Y9LKR0_BCL2A1-      EEISSLPKTSWNIHQPSEVEVREEALSTGSL----LSSTTSEPVEMRVCQ
A0A2Y9LKR0_BCL2A1-      EEISSLPKTSWNIHQPSEVEVREEALSTGSL----LSSTTSEPVEMRVCQ
A0A2Y9LKR0_BCL2A1-      EEISSLPKTSWNIHQPSEVEVREEALSTAHR----LSLVAASG-------
                         ** .* *  :                                       

A0A2Y9LKR0_BCL2A1-      VFYHSFTGLMKRVGILWTRTWNFLSVLRAHVARRVVFCPVWK----LGQR
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      VFYHSFTGLMKRVGILWTRTWNFLSVLRAHVARRVVFCPVWK----LGQR
A0A2Y9LKR0_BCL2A1-      -------------------------------GKGYYDAYLKRCLQSQDVR
A0A2Y9LKR0_BCL2A1-      -------------------------------ADPVESCNSWRNLCSSTQT
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
A0A2Y9LKR0_BCL2A1-      --------------------------------------------------
                                                                          

A0A2Y9LKR0_BCL2A1-      NWCSCVMRSSFKSTRRFFVLLTQTQRFLAAIPPPKCQERGLQMPPKSTG
A0A2Y9LKR0_BCL2A1-      -------------------------------------------------
A0A2Y9LKR0_BCL2A1-      NWCSCVMRSSFKSTRRFFVLLTQTQRFLAAIPPPKCQERGLQMPPKSTG
A0A2Y9LKR0_BCL2A1-      PYTLALAFKEQICL------QVPVDENDMKVDEVLYEDSSAS-------
A0A2Y9LKR0_BCL2A1-      RTGLPLVSSANKCVTSHFLKKLPNSGTVYSLASLLLEEFTTADSSWGNC
A0A2Y9LKR0_BCL2A1-      ------------------------VESSISYPPPPRPTYCQPEKWELTP
A0A2Y9LKR0_BCL2A1-      -------------------------------------------------
                                                                         

© 1998-2021Legal notice