Dataset for protein Bfl1 of organism Delphinapterus leucas

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=313 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGSLLSSTTSEPVE
MRVCQADPVESCNSWRNLCSSTQTRTGLPLVSSANKCVTSHFLKKLPNSGTVYSLASLLLEEFTTADSSWGNC
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=340 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGSLLSSTTSEPVE
MRVCQVFYHSFTGLMKRVGILWTRTWNFLSVLRAHVARRVVFCPVWKLGQRNWCSCVMRSSFKSTRRFFVLLTQTQRFLA
AIPPPKCQERGLQMPPKSTG
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-07 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=175 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWENGFVKKFEPKSGWLTFLEV
TGKICEILCLLKQYY
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-06 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=238 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTAHRLSLVAASG
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-05 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=304 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGGLDLIFMPGLGF
DKHGNRLGRGKGYYDAYLKRCLQSQDVRPYTLALAFKEQICLQVPVDENDMKVDEVLYEDSSAS
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-04 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=270 residues).
MTDSEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDVAFSVQNEVEKNLKPCLDNIDVVSIDTARTIFNQVMEREFE
DGIVNWGRIVTIFAFEGILIKKLLGGRIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWVFTHSQYQKSKRISIFLSMQ
DEIETEEIIKDIFQQGKTCFIPRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGSLLSSTTSEPVE
MRVCQVESSISYPPPPRPTYCQPEKWELTP
>gnl|bcl2dbpro|A0A2Y9LKR0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Delphinapterus leucas GN=BCL2A1 (length=239 residues).
MAATAVSSAKRSLRAELKRRLRALSAEERLRQSRLLAQKVFTHSQYQKSKRISIFLSMQDEIETEEIIKDIFQQGKTCFI
PRYQFQSNHMDMVKLASPEEISSLPKTSWNIHQPSEVEVREEALSTGSLLSSTTSEPVEMRVCQVFYHSFTGLMKRVGIL
WTRTWNFLSVLRAHVARRVVFCPVWKLGQRNWCSCVMRSSFKSTRRFFVLLTQTQRFLAAIPPPKCQERGLQMPPKSTG
© 1998-2020Legal notice