Dataset for protein Mcl-1 of organism Cyprinus carpio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .  :     ***.*  ..:  .  *    :*.:::*: *                ***:           
mfpgskvsndnglwpcigiAALnVnnsssgfgrkPlvmpePkaqnEfaG----------------NGLq-----------
---------mtlsfgikrt   s faqgahtslv gpalk rted ld yaddteaalkpprpgt   kglqldgrfvsa

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  **:*::*:..    *:       * :***:::  * .:.**:  ..  .:: *.**.*** .:::**:::****: **
--GSvPssPesdceeiVdyspvcaaLemDTReiidiFlksfTGlphsksgkkqiLsTMkRVVdslvvKHelaYKGMiaRL
gd  l at dpkelgs e------- hl   qlmld yrth  mcppdrkrhha p  r   adili  qit    lq  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:*:.: :*:**:. :*. :*.*  ******.**::***:**.: ::   .:**. *.*:*****:::*. ***:**:* *
nLeekgeDvSFvktvAtelFsDgiTNWGRIaSLltFGAiVCkhqndrglskCVslVgEeISSYLltdQrhWLLkNKaWdG
q dsqpd m  isci ktm k ht      v  va   v  tqlkelqreq  ea a q     ise hd   n  s h 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* ***.* *.*..**.****: . * :**.** ***                                            
FeEFFhVpDtEgaVRnALMAigsfAtfGAaLAyLIR--------------------------------------------
 v   r e v sv  s    vvgc gi  g  l   psvgsnedygndthraspdppahcgstccgylsqavklsgiqvk

       330     
....:....|....:
               
---------------
pcdntctnlhilvlw
© 1998-2023Legal notice