Dataset for protein Mcl-1 of organism Cyprinus carpio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mfpgskvsndnglwpcigiaalnvnnsss--g-kplvmpep----ktqnefag---------------------------
----------------aalsvfaqgaht-gf-r---lv-g-alkpraed-ld-yaddtdaalkpprpgtnglkglqldgr
      mtlsf ikrt------------ ll ahtq-- -l   a----p--rc  e e  m  f          h    
            f   mt tlmrrtstv       aia a           t                            
                        s r                                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 .:      .:     * *::           
--nglqgsvpsspesdceetvd----spvcaalemdtreiidiflksftglphsksgkkqilstMkRvvdslvvkhelay
fvsagd--l-at-dpk---i--eyty-------hl---qlmld-yrthmsmcppdrkrhhagpr r lladili--qit-
y ----  - -- ---elg-pe   snriyde --   ----- ----n  afrrapq tv n  t   ea---  --- 
    a     nl   q  ks      efgs   gr   r l     n      l   n    e  s       l      
                                                                 n              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :: .* .                                                            
kgmiarlnleekgedvsFvktvatelfsdgitnwgriaslltfgaivckhqndrglskcvslvgeeissylltdqrhwll
---lq--q-dsqpdeme isci-ktm-k-ht------v--va---v--tqlkelqrer--ea-a-q-----ise-hd---
   --  - ---e  d  y  - --- - --s     -  --   -  ----------  -- -k-  n  --- --   
          qe                                 m       k  tn   t           a      
                                                         q                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :: .                   :                                                     
knkawdG-----------------Fveffhvpdtegavrnalmaigsfatfgaalaylir--------------------
n--syhsdhtlvfpslrnsepfcvced--r-e-v-sv--s----vvgc-gi--g------psvgsnedygndthraspdp
-  g                   h ss-f-t- --i -pekp----p--ss-p l                       
     v                       p n r tc  p    llnv  s     f                       
                                               s                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pahcgstccgylsqavklsgiqesgseeykgdlsetedevdsdfdidegdepdseqeedgprrksrvvtkawkepvkvvr
                      gkrdh                      pvsqesvsfsvtalermhcmhfytsrlrnhv
                      vlicd                      nsc           tkl ilvl aghhah q
                        p                         t             n               

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
qkpkqrklaelprrtvktkinkynppelqedinknrksvrqsttehtrltylrlqerqvaprrrkgtrherpltqaella
rqnrsmlkfg intvgylnffrvslffffcfffltkcyaqmllpvikmiik mifskniye                   
nndhgkh  f     a                  setf ly hmhm                                  
                                            g                                   

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
eakvtaqinlrslenyerleadkkrqvhmkrqcvgsviryhsvlmplvsdvtlkeenvdvegldqdaqqnpgphpsqals
                                                                                
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
qsestltappsvfssntaavnpslssgpakcsrtyitfsddeslqrffpqspppripvqeicpvthkpalyrdpitdipy
                                                                                
                                                                                
                                                                                

       650       660       670       680        
....:....|....:....|....:....|....:....|....:...
                                                
------------------------------------------------
anvqafriireaykkyvaahglpstgtatpadttaknlrqkiiikqgm
                           v                    
                                                
                                                
© 1998-2022Legal notice