Dataset for protein Mcl-1 of organism Cyprinus carpio

[Download (right click)] [Alignment] [Repertoires]

18 sequence(s)

>gnl|bcl2dbpro|A0A8C1JUN1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=306 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEEIVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQVKPCDNTCTNLHILVLW
>gnl|bcl2dbpro|A0A8C1JUN1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=247 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEEIVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIR
>gnl|bcl2dbpro|A0A8C1PPB3_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=257 residues).
MTLSLMRRTATVSLLGAHTALAPAPALKARTEDELDGCADETDAAMKPFRPGTNGLKGLHLDGRYVSAADGSLPNTPDPQ
EFGSAELGRDTRRLLLDFYRTHTGLCPRDRKQHHALPTMTRVVADILLKHEIAYKGMLQRLQLDSQPDDMSFISCIAKTM
FKDHTTNWGRIVSLVAFGAVVCTHLKELQRERCVETVAEQISSYLISEQHDWLLNNKSWHGFVEFFRVEDVESVVRNALM
AVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A8C1X8V5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=257 residues).
MTLSLMRRTATVSLLGAHTALAPAPALKARTEDELDGCADETDAAMKPFRPGTNGLKGLHLDGRYVSAADGSLPNTPDPQ
EFGSAELGRDTRRLLLDFYRTHTGLCPRDRKQHHALPTMTRVVADILLKHEIAYKGMLQRLQLDSQPDDMSFISCIAKTM
FKDHTTNWGRIVSLVAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSWHGFVEFFRVEDVESVVRNALM
AVVGCAGIGAGLAFLIR
>gnl|bcl2dbpro|A0A8C1Y6A5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=246 residues).
MFPGSKVSNDNGFWPCIGITALNVSSRSSKPQIMPELKTQNPFTRNGLQGSVPSSPESDCEKTPDEYTSNRIYDALEMDT
REIIDIFLKNFNGLPHSKRGNKQVLETMNRVVESLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWGRI
ASLLTFGAMVCKHQKDKGLTNCVSLVGKEISNYLLTAQRDWLLKNKAWDGFVEFFRVPDTEGAVRNALMAIGSVATFGAA
LAYLIR
>gnl|bcl2dbpro|A0A8C1YDY0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=260 residues).
MTLSFGIKRTAALSVFAQGAHTSLVPGPALKPRTEDELDGYADDTEAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATP
DPKELGSVELHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTMRRVVADILIKHQITYKGMLQRLQLDSQPDDMSFISCIA
KTMFKDHTTNWGRIVSLVAFGAVVCTQLKELQREQCVEAVAEQISSYLISEQHDWLLNNKSWHGFVEFFRVEDVESVVRS
ALMAVVGCAGIGAGLALLIR
>gnl|bcl2dbpro|A0A8C2A7Q5_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=319 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEEIVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQEKRSHDVSERWAGHLRHHVRQNRSKHKFGL
>gnl|bcl2dbpro|A0A8C2A7Q5_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=385 residues).
MSLAFSRAPRKTAGNRMSRLLDAEEEDEFYKTTYGGFHDESGDEEYKGDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRR
KSRVVTKAYKEPVKVVRQKPKQRKLAELPRRTVKTKINKYNPPELQEDINKNRKSVRQSTTEHTRLTYLRLQERQVAPRR
RKGTRHERPLTQAELLAEAKVTAQINLRSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDVEGL
DQDAQQNPGPHPSQALSQSESTLTAPPSVFSSNTAAVNPSLSSGPAKCSRTYITFSDDESLQRFFPQSPPPRIPVQEICP
VTHKPALYRDPITDIPYANVQAFRIIREAYKKYVAAHGLPSTGTVTPADTTAKNLRQKIIIKQGM
>gnl|bcl2dbpro|A0A8C2A7Q5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=393 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEEIVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQESGDEEYKGDLSETEDEVDSDFDIDEGDEPD
SEQEEDGPRRKSRVVTKAYKEPVKVVRQKPKQRKLAELPRRTVKTKINKYNPPELQEDINKSETFALYLHMHM
>gnl|bcl2dbpro|A0A8C2A7Q5_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=382 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEEIVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQGLISEPSPQESVSFSVTALEKMVCMHFWTSR
HANVQNNDHGMLLAFLINTVAYLNFFRVSLFFLFCFLTKCYAQMSLPGIKMIIKLMIFSKNI
>gnl|bcl2dbpro|A0A8C2BAP8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=260 residues).
MTLSFGIKRTAALSVFAQGAHTSLVPGPALKPRTEDELDGYADDTDAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATP
DPKELGSVELHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTMRRVVADILIKHQITYKGMLQRLQLDSQPDDMSFISCIA
KTMFKDHTTNWGRIVSLVAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSWHGFVEFFRVEDVESVVRS
ALMAVVGCAGIGAGLALLIR
>gnl|bcl2dbpro|A0A8C2BAP8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=272 residues).
MTLSFGIKRTAALSVFAQGAHTSLVPGPALKPRTEDELDGYADDTDAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATP
DPKELGSVELHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTMRRVVADILIKHQITYKGMLQRLQLDSQPDDMSFISCIA
KTMFKDHTTNWGRIVSLVAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSWVSDHTLVFPSLRNSEPFC
VCVESSPFNTRETCIRPPEKPLLNSPTSSSAP
>gnl|bcl2dbpro|A0A8C2BPF9_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=260 residues).
MTLSFGIKRTAALSVFAQGAHTSLVPGPALKPRTEDELDGYADDTDAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATP
DPKELGSVELHLDTRQLMLDFYRTHTGMCPLDRKRHHALPTMRRVVADILIKHQITYKGMLQRLQLDSEPDDMSFISCIA
KTMFKDHTTNWGRIVSLVAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSWHGFVEFFRVEDVESVVRS
ALMAVVGCAGIGAGLALLIR
>gnl|bcl2dbpro|A0A8C2BR28_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=246 residues).
MFPGSKVSNDNGFWPCIGITALNVSSRSSKPQVMPELKTQNPFTRNGLQGSVPSLPESDCEKTPDEYTSNRIYDALEMDT
REIIDIFLKNFTGLPHSKRGNKQVLETMNRVVESLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGISNWGRI
ASLLTFGAMVCKHQKDKGLSNCVSLVGKEISNYLLTAQRDWLLKNKAWDGFVEFFRVPDTEGAVRNALMAIGSVATFGAA
LAYLIR
>gnl|bcl2dbpro|A0A8C2KHZ4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=319 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEETVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQEKRSHDVSERWAGHLRHHVRQNRSKHKFGL
>gnl|bcl2dbpro|A0A8C2KHZ4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=635 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEETVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQESGDEEYKGDLSETEDEVDSDFDIDEGDEPD
SEQEEDGPRRKSRVVTKAYKEPVKVVRQKPKQRKLAELPRRTVKTKINKYNPPELQEDINKNRKSVRQSTTEHTRLTYLR
LQERQVAPRRRKGTRHERPLTQAELLAEAKVTAQINLRSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTL
KEENVDVEGLDQDAQQNPGPHPSQALSQSESTLTAPPSVFSSNTAAVNPSLSSGPAKCSRTYITFSDDESLQRFFPQSPP
PRIPVQEICPVTHKPALYRDPITDIPYANVQAFRIIREAYKKYVAAHGLPSTGTATPADTTAKNLRQKIIIKQGM
>gnl|bcl2dbpro|A0A8C2KHZ4_MCL1-04 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=385 residues).
MSLAFSRAPRKTAGNRMSRLLDAEEEDEFYKTTYGGFHDESGDEEYKGDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRR
KSRVVTKAYKEPVKVVRQKPKQRKLAELPRRTVKTKINKYNPPELQEDINKNRKSVRQSTTEHTRLTYLRLQERQVAPRR
RKGTRHERPLTQAELLAEAKVTAQINLRSLENYERLEADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDVEGL
DQDAQQNPGPHPSQALSQSESTLTAPPSVFSSNTAAVNPSLSSGPAKCSRTYITFSDDESLQRFFPQSPPPRIPVQEICP
VTHKPALYRDPITDIPYANVQAFRIIREAYKKYVAAHGLPSTGTATPADTTAKNLRQKIIIKQGM
>gnl|bcl2dbpro|A0A8C2KHZ4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=386 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEETVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQGLISEPSPQESVSFSVTALEKMVCMHFWTSR
HANVQNNDHGMLLAFLINTVGYLNFFRVSLFFFFCFFFLTKCYAQMSLPVIKMIIKLMIFSKNIYE
© 1998-2022Legal notice