Dataset for protein Mcl-1 of organism Cyprinus carpio

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C1JUN1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=247 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEEIVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIR
>gnl|bcl2dbpro|A0A8C1JUN1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=306 residues).
MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAGNGLQGSVPSSPESDCEEIVDYSPVCAALEMD
TREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGR
IASLLTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDTEGAVRNALMAIGSFATFGA
ALAYLIRPSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQVKPCDNTCTNLHILVLW
>gnl|bcl2dbpro|A0A8C1YDY0_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyprinus carpio GN=MCL-1 (length=260 residues).
MTLSFGIKRTAALSVFAQGAHTSLVPGPALKPRTEDELDGYADDTEAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATP
DPKELGSVELHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTMRRVVADILIKHQITYKGMLQRLQLDSQPDDMSFISCIA
KTMFKDHTTNWGRIVSLVAFGAVVCTQLKELQREQCVEAVAEQISSYLISEQHDWLLNNKSWHGFVEFFRVEDVESVVRS
ALMAVVGCAGIGAGLALLIR
© 1998-2023Legal notice