Dataset for protein Mcl-1 of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

18 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2BAP8_MCL1-02      ------MTLSFGIKRTAALSVFAQGAHTS-------LVPGPALKPRTEDE
A0A8C2BPF9_MCL1-01      ------MTLSFGIKRTAALSVFAQGAHTS-------LVPGPALKPRTEDE
A0A8C1YDY0_MCL1-01      ------MTLSFGIKRTAALSVFAQGAHTS-------LVPGPALKPRTEDE
A0A8C2BAP8_MCL1-01      ------MTLSFGIKRTAALSVFAQGAHTS-------LVPGPALKPRTEDE
A0A8C1Y6A5_MCL1-01      MFPGSKVSNDNGFWPCIGITALNVSSRSS----KPQIMPEL----KTQNP
A0A8C2BR28_MCL1-01      MFPGSKVSNDNGFWPCIGITALNVSSRSS----KPQVMPEL----KTQNP
A0A8C1PPB3_MCL1-01      ----------------MTLSLMRRTATVSLLGAHTALAPAPALKARTEDE
A0A8C1X8V5_MCL1-01      ----------------MTLSLMRRTATVSLLGAHTALAPAPALKARTEDE
A0A8C2A7Q5_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-01      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----KAQNE
A0A8C2A7Q5_MCL1-01      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----KAQNE
A0A8C2A7Q5_MCL1-02      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----KAQNE
A0A8C2KHZ4_MCL1-02      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----KAQNE
A0A8C1JUN1_MCL1-02      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----KAQNE
A0A8C1JUN1_MCL1-01      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----KAQNE
A0A8C2A7Q5_MCL1-03      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----KAQNE
A0A8C2KHZ4_MCL1-03      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEP----KAQNE
                                                                          

A0A8C2BAP8_MCL1-02      LDGYADDTDAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDPKELGS
A0A8C2BPF9_MCL1-01      LDGYADDTDAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDPKELGS
A0A8C1YDY0_MCL1-01      LDGYADDTEAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDPKELGS
A0A8C2BAP8_MCL1-01      LDGYADDTDAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDPKELGS
A0A8C1Y6A5_MCL1-01      FTR-----------------------------NGLQGSVPSSPESDCEKT
A0A8C2BR28_MCL1-01      FTR-----------------------------NGLQGSVPSLPESDCEKT
A0A8C1PPB3_MCL1-01      LDGCADETDAAMKPFRPGTNGLKGLHLDGRYVSAADGSLPNTPDPQ----
A0A8C1X8V5_MCL1-01      LDGCADETDAAMKPFRPGTNGLKGLHLDGRYVSAADGSLPNTPDPQ----
A0A8C2A7Q5_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-04      --------------------------------------------------
A0A8C2KHZ4_MCL1-01      FAG-----------------------------NGLQGSVPSSPESDCEET
A0A8C2A7Q5_MCL1-01      FAG-----------------------------NGLQGSVPSSPESDCEEI
A0A8C2A7Q5_MCL1-02      FAG-----------------------------NGLQGSVPSSPESDCEEI
A0A8C2KHZ4_MCL1-02      FAG-----------------------------NGLQGSVPSSPESDCEET
A0A8C1JUN1_MCL1-02      FAG-----------------------------NGLQGSVPSSPESDCEEI
A0A8C1JUN1_MCL1-01      FAG-----------------------------NGLQGSVPSSPESDCEEI
A0A8C2A7Q5_MCL1-03      FAG-----------------------------NGLQGSVPSSPESDCEEI
A0A8C2KHZ4_MCL1-03      FAG-----------------------------NGLQGSVPSSPESDCEET
                                                                          

A0A8C2BAP8_MCL1-02      VE----------LHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTMRRVVA
A0A8C2BPF9_MCL1-01      VE----------LHLDTRQLMLDFYRTHTGMCPLDRKRHHALPTMRRVVA
A0A8C1YDY0_MCL1-01      VE----------LHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTMRRVVA
A0A8C2BAP8_MCL1-01      VE----------LHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTMRRVVA
A0A8C1Y6A5_MCL1-01      PDEYTSNRIYDALEMDTREIIDIFLKNFNGLPHSKRGNKQVLETMNRVVE
A0A8C2BR28_MCL1-01      PDEYTSNRIYDALEMDTREIIDIFLKNFTGLPHSKRGNKQVLETMNRVVE
A0A8C1PPB3_MCL1-01      ------EFGSAELGRDTRRLLLDFYRTHTGLCPRDRKQHHALPTMTRVVA
A0A8C1X8V5_MCL1-01      ------EFGSAELGRDTRRLLLDFYRTHTGLCPRDRKQHHALPTMTRVVA
A0A8C2A7Q5_MCL1-04      ----------------------------MSLAFSRAPRKTAGNRMSRLLD
A0A8C2KHZ4_MCL1-04      ----------------------------MSLAFSRAPRKTAGNRMSRLLD
A0A8C2KHZ4_MCL1-01      VD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVD
A0A8C2A7Q5_MCL1-01      VD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVD
A0A8C2A7Q5_MCL1-02      VD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVD
A0A8C2KHZ4_MCL1-02      VD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVD
A0A8C1JUN1_MCL1-02      VD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVD
A0A8C1JUN1_MCL1-01      VD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVD
A0A8C2A7Q5_MCL1-03      VD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVD
A0A8C2KHZ4_MCL1-03      VD---YSPVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVD
                                                     .:      .:     * *:: 

A0A8C2BAP8_MCL1-02      DILIKHQITYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWGRIVSL
A0A8C2BPF9_MCL1-01      DILIKHQITYKGMLQRLQLDSEPDDMSFISCIAKTMFKDHTTNWGRIVSL
A0A8C1YDY0_MCL1-01      DILIKHQITYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWGRIVSL
A0A8C2BAP8_MCL1-01      DILIKHQITYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWGRIVSL
A0A8C1Y6A5_MCL1-01      SLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGITNWGRIASL
A0A8C2BR28_MCL1-01      SLVVKHELAYKGMIARLNLEQKGEDVSFVKTVATELFSDGISNWGRIASL
A0A8C1PPB3_MCL1-01      DILLKHEIAYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWGRIVSL
A0A8C1X8V5_MCL1-01      DILLKHEIAYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWGRIVSL
A0A8C2A7Q5_MCL1-04      A---------------------EEEDEFYKT-------------------
A0A8C2KHZ4_MCL1-04      A---------------------EEEDEFYKT-------------------
A0A8C2KHZ4_MCL1-01      SLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASL
A0A8C2A7Q5_MCL1-01      SLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASL
A0A8C2A7Q5_MCL1-02      SLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASL
A0A8C2KHZ4_MCL1-02      SLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASL
A0A8C1JUN1_MCL1-02      SLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASL
A0A8C1JUN1_MCL1-01      SLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASL
A0A8C2A7Q5_MCL1-03      SLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASL
A0A8C2KHZ4_MCL1-03      SLVVKHELAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASL
                                               :: .* .                    

A0A8C2BAP8_MCL1-02      VAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSWVSDHT
A0A8C2BPF9_MCL1-01      VAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSWHG---
A0A8C1YDY0_MCL1-01      VAFGAVVCTQLKELQREQCVEAVAEQISSYLISEQHDWLLNNKSWHG---
A0A8C2BAP8_MCL1-01      VAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSWHG---
A0A8C1Y6A5_MCL1-01      LTFGAMVCKHQKDKGLTNCVSLVGKEISNYLLTAQRDWLLKNKAWDG---
A0A8C2BR28_MCL1-01      LTFGAMVCKHQKDKGLSNCVSLVGKEISNYLLTAQRDWLLKNKAWDG---
A0A8C1PPB3_MCL1-01      VAFGAVVCTHLKELQRERCVETVAEQISSYLISEQHDWLLNNKSWHG---
A0A8C1X8V5_MCL1-01      VAFGAVVCTQLKELQRERCVEAVAEQISSYLISEQHDWLLNNKSWHG---
A0A8C2A7Q5_MCL1-04      -------------------------------------------TYGG---
A0A8C2KHZ4_MCL1-04      -------------------------------------------TYGG---
A0A8C2KHZ4_MCL1-01      LTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDG---
A0A8C2A7Q5_MCL1-01      LTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDG---
A0A8C2A7Q5_MCL1-02      LTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDG---
A0A8C2KHZ4_MCL1-02      LTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDG---
A0A8C1JUN1_MCL1-02      LTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDG---
A0A8C1JUN1_MCL1-01      LTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDG---
A0A8C2A7Q5_MCL1-03      LTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDG---
A0A8C2KHZ4_MCL1-03      LTFGAIVCKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDG---
                                                                   :: .   

A0A8C2BAP8_MCL1-02      LVFPSLRNSEPFCVCVESSPFNTRETCIRPPEKPLLNSPTSSSAP-----
A0A8C2BPF9_MCL1-01      --------------FVEFFRVEDVESVVRSALMAVVGCAGIGAGLALLIR
A0A8C1YDY0_MCL1-01      --------------FVEFFRVEDVESVVRSALMAVVGCAGIGAGLALLIR
A0A8C2BAP8_MCL1-01      --------------FVEFFRVEDVESVVRSALMAVVGCAGIGAGLALLIR
A0A8C1Y6A5_MCL1-01      --------------FVEFFRVPDTEGAVRNALMAIGSVATFGAALAYLIR
A0A8C2BR28_MCL1-01      --------------FVEFFRVPDTEGAVRNALMAIGSVATFGAALAYLIR
A0A8C1PPB3_MCL1-01      --------------FVEFFRVEDVESVVRNALMAVVGCAGIGAGLAFLIR
A0A8C1X8V5_MCL1-01      --------------FVEFFRVEDVESVVRNALMAVVGCAGIGAGLAFLIR
A0A8C2A7Q5_MCL1-04      --------------FHD---------------------------------
A0A8C2KHZ4_MCL1-04      --------------FHD---------------------------------
A0A8C2KHZ4_MCL1-01      --------------FEEFFHVPDTEGAVRNALMAIGSFATFGAALAYLIR
A0A8C2A7Q5_MCL1-01      --------------FEEFFHVPDTEGAVRNALMAIGSFATFGAALAYLIR
A0A8C2A7Q5_MCL1-02      --------------FEEFFHVPDTEGAVRNALMAIGSFATFGAALAYLIR
A0A8C2KHZ4_MCL1-02      --------------FEEFFHVPDTEGAVRNALMAIGSFATFGAALAYLIR
A0A8C1JUN1_MCL1-02      --------------FEEFFHVPDTEGAVRNALMAIGSFATFGAALAYLIR
A0A8C1JUN1_MCL1-01      --------------FEEFFHVPDTEGAVRNALMAIGSFATFGAALAYLIR
A0A8C2A7Q5_MCL1-03      --------------FEEFFHVPDTEGAVRNALMAIGSFATFGAALAYLIR
A0A8C2KHZ4_MCL1-03      --------------FEEFFHVPDTEGAVRNALMAIGSFATFGAALAYLIR
                                        :                                 

A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      ------------------------------------------ESGDEEYK
A0A8C2KHZ4_MCL1-04      ------------------------------------------ESGDEEYK
A0A8C2KHZ4_MCL1-01      PSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQESGDEEYK
A0A8C2A7Q5_MCL1-01      PSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQESGDEEYK
A0A8C2A7Q5_MCL1-02      PSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQGLISE---
A0A8C2KHZ4_MCL1-02      PSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQGLISE---
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      PSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQVKPCD---
A0A8C2A7Q5_MCL1-03      PSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQEKRSH---
A0A8C2KHZ4_MCL1-03      PSVGSNEDYGNDTHRASPDPPAHCGSTCCGYLSQAVKLSGIQEKRSH---
                                                                          

A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      GDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRRKSRVVTKAYKEPVKVVR
A0A8C2KHZ4_MCL1-04      GDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRRKSRVVTKAYKEPVKVVR
A0A8C2KHZ4_MCL1-01      GDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRRKSRVVTKAYKEPVKVVR
A0A8C2A7Q5_MCL1-01      GDLSETEDEVDSDFDIDEGDEPDSEQEEDGPRRKSRVVTKAYKEPVKVVR
A0A8C2A7Q5_MCL1-02      -------------------PSPQESVSFSVTALEKMVCMHFWTSRHANVQ
A0A8C2KHZ4_MCL1-02      -------------------PSPQESVSFSVTALEKMVCMHFWTSRHANVQ
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      -------------------NTC-----------TNLHILVLW--------
A0A8C2A7Q5_MCL1-03      -------------------DVS-----------ER------WAGHLRHHV
A0A8C2KHZ4_MCL1-03      -------------------DVS-----------ER------WAGHLRHHV
                                                                          

A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      QKPKQRKLAELPRRTVKTKINKYNPPELQEDINKNRKSVRQSTTEHTRLT
A0A8C2KHZ4_MCL1-04      QKPKQRKLAELPRRTVKTKINKYNPPELQEDINKNRKSVRQSTTEHTRLT
A0A8C2KHZ4_MCL1-01      QKPKQRKLAELPRRTVKTKINKYNPPELQEDINKNRKSVRQSTTEHTRLT
A0A8C2A7Q5_MCL1-01      QKPKQRKLAELPRRTVKTKINKYNPPELQEDINKSETFALYLHMHM----
A0A8C2A7Q5_MCL1-02      NNDHGMLLAFLINTVAYLNFFRVSLFFLFC--FLTKCYAQMSLPGIKMII
A0A8C2KHZ4_MCL1-02      NNDHGMLLAFLINTVGYLNFFRVSLFFFFCFFFLTKCYAQMSLPVIKMII
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      RQNRSKHKFGL---------------------------------------
A0A8C2KHZ4_MCL1-03      RQNRSKHKFGL---------------------------------------
                                                                          

A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      YLRLQERQVAPRRRKGTRHERPLTQAELLAEAKVTAQINLRSLENYERLE
A0A8C2KHZ4_MCL1-04      YLRLQERQVAPRRRKGTRHERPLTQAELLAEAKVTAQINLRSLENYERLE
A0A8C2KHZ4_MCL1-01      YLRLQERQVAPRRRKGTRHERPLTQAELLAEAKVTAQINLRSLENYERLE
A0A8C2A7Q5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-02      KLMIFSKNI-----------------------------------------
A0A8C2KHZ4_MCL1-02      KLMIFSKNIYE---------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      --------------------------------------------------
A0A8C2KHZ4_MCL1-03      --------------------------------------------------
                                                                          

A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      ADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDVEGLDQDAQQN
A0A8C2KHZ4_MCL1-04      ADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDVEGLDQDAQQN
A0A8C2KHZ4_MCL1-01      ADKKRQVHMKRQCVGSVIRYHSVLMPLVSDVTLKEENVDVEGLDQDAQQN
A0A8C2A7Q5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-02      --------------------------------------------------
A0A8C2KHZ4_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      --------------------------------------------------
A0A8C2KHZ4_MCL1-03      --------------------------------------------------
                                                                          

A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      PGPHPSQALSQSESTLTAPPSVFSSNTAAVNPSLSSGPAKCSRTYITFSD
A0A8C2KHZ4_MCL1-04      PGPHPSQALSQSESTLTAPPSVFSSNTAAVNPSLSSGPAKCSRTYITFSD
A0A8C2KHZ4_MCL1-01      PGPHPSQALSQSESTLTAPPSVFSSNTAAVNPSLSSGPAKCSRTYITFSD
A0A8C2A7Q5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-02      --------------------------------------------------
A0A8C2KHZ4_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      --------------------------------------------------
A0A8C2KHZ4_MCL1-03      --------------------------------------------------
                                                                          

A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-04      DESLQRFFPQSPPPRIPVQEICPVTHKPALYRDPITDIPYANVQAFRIIR
A0A8C2KHZ4_MCL1-04      DESLQRFFPQSPPPRIPVQEICPVTHKPALYRDPITDIPYANVQAFRIIR
A0A8C2KHZ4_MCL1-01      DESLQRFFPQSPPPRIPVQEICPVTHKPALYRDPITDIPYANVQAFRIIR
A0A8C2A7Q5_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-02      --------------------------------------------------
A0A8C2KHZ4_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      --------------------------------------------------
A0A8C2KHZ4_MCL1-03      --------------------------------------------------
                                                                          

A0A8C2BAP8_MCL1-02      --------------------------------------
A0A8C2BPF9_MCL1-01      --------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------
A0A8C1Y6A5_MCL1-01      --------------------------------------
A0A8C2BR28_MCL1-01      --------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------
A0A8C2A7Q5_MCL1-04      EAYKKYVAAHGLPSTGTVTPADTTAKNLRQKIIIKQGM
A0A8C2KHZ4_MCL1-04      EAYKKYVAAHGLPSTGTATPADTTAKNLRQKIIIKQGM
A0A8C2KHZ4_MCL1-01      EAYKKYVAAHGLPSTGTATPADTTAKNLRQKIIIKQGM
A0A8C2A7Q5_MCL1-01      --------------------------------------
A0A8C2A7Q5_MCL1-02      --------------------------------------
A0A8C2KHZ4_MCL1-02      --------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------
A0A8C1JUN1_MCL1-01      --------------------------------------
A0A8C2A7Q5_MCL1-03      --------------------------------------
A0A8C2KHZ4_MCL1-03      --------------------------------------
                                                              

© 1998-2022Legal notice