Dataset for protein Mcl-1 of organism Cyprinus carpio

[Download (right click)] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C2A7Q5_MCL1-04      MSLAFSRAPR---------KTAG-NRMSRLLDAEEEDEFYKTTYGGFHDE
A0A8C2A7Q5_MCL1-02      MFPGSKV--SNDNGLWPCIGIAALNVNNSS----------------SG--
A0A8C1JUN1_MCL1-01      MFPGSKV--SNDNGLWPCIGIAALNVNNSS----------------SG--
A0A8C2A7Q5_MCL1-03      MFPGSKV--SNDNGLWPCIGIAALNVNNSS----------------SG--
A0A8C2A7Q5_MCL1-01      MFPGSKV--SNDNGLWPCIGIAALNVNNSS----------------SG--
A0A8C1Y6A5_MCL1-01      MFPGSKV--SNDNGFWPCIGITALNVSSRS----------------S---
A0A8C2BAP8_MCL1-02      MTLSFGI--K---------RTAALSVFAQG----------------AH--
A0A8C2BAP8_MCL1-01      MTLSFGI--K---------RTAALSVFAQG----------------AH--
A0A8C1JUN1_MCL1-02      MFPGSKV--SNDNGLWPCIGIAALNVNNSS----------------SG--
A0A8C1PPB3_MCL1-01      MTLSL-M--R---------RTATVSLL--G----------------AH--
A0A8C1X8V5_MCL1-01      MTLSL-M--R---------RTATVSLL--G----------------AH--
A0A8C1YDY0_MCL1-01      MTLSFGI--K---------RTAALSVFAQG----------------AH--
                        *  .                 :  .                         

A0A8C2A7Q5_MCL1-04      SGDEEYKG--DLSETEDEVDSDFD-IDEGDEPDSE--QEEDGPRRKSRVV
A0A8C2A7Q5_MCL1-02      --FGRKPLVMPEPKAQNEFAG----------------NGL----------
A0A8C1JUN1_MCL1-01      --FGRKPLVMPEPKAQNEFAG----------------NGL----------
A0A8C2A7Q5_MCL1-03      --FGRKPLVMPEPKAQNEFAG----------------NGL----------
A0A8C2A7Q5_MCL1-01      --FGRKPLVMPEPKAQNEFAG----------------NGL----------
A0A8C1Y6A5_MCL1-01      -----KPQIMPELKTQNPFTR----------------NGL----------
A0A8C2BAP8_MCL1-02      --TSLVPGPALKPRTEDELDGYADDTDAALKPPRPGTNGLKGLQLDGRFV
A0A8C2BAP8_MCL1-01      --TSLVPGPALKPRTEDELDGYADDTDAALKPPRPGTNGLKGLQLDGRFV
A0A8C1JUN1_MCL1-02      --FGRKPLVMPEPKAQNEFAG----------------NGL----------
A0A8C1PPB3_MCL1-01      --TALAPAPALKARTEDELDGCADETDAAMKPFRPGTNGLKGLHLDGRYV
A0A8C1X8V5_MCL1-01      --TALAPAPALKARTEDELDGCADETDAAMKPFRPGTNGLKGLHLDGRYV
A0A8C1YDY0_MCL1-01      --TSLVPGPALKPRTEDELDGYADDTEAALKPPRPGTNGLKGLQLDGRFV
                                     .::: .                  :            

A0A8C2A7Q5_MCL1-04      TKAYKEPVKVVRQKPKQRKLAELPRRTVKTKINK-Y--NPPELQEDINKN
A0A8C2A7Q5_MCL1-02      ---QGS--VPSSPESDCEE------------IVD-Y--SP----------
A0A8C1JUN1_MCL1-01      ---QGS--VPSSPESDCEE------------IVD-Y--SP----------
A0A8C2A7Q5_MCL1-03      ---QGS--VPSSPESDCEE------------IVD-Y--SP----------
A0A8C2A7Q5_MCL1-01      ---QGS--VPSSPESDCEE------------IVD-Y--SP----------
A0A8C1Y6A5_MCL1-01      ---QGS--VPSSPESDCEK------------TPDEYTSNR----------
A0A8C2BAP8_MCL1-02      SAGDGS--LPATPDPKELG-------------------------------
A0A8C2BAP8_MCL1-01      SAGDGS--LPATPDPKELG-------------------------------
A0A8C1JUN1_MCL1-02      ---QGS--VPSSPESDCEE------------IVD-Y--SP----------
A0A8C1PPB3_MCL1-01      SAADGS--LPNTPDPQEFG-------------------------------
A0A8C1X8V5_MCL1-01      SAADGS--LPNTPDPQEFG-------------------------------
A0A8C1YDY0_MCL1-01      SAGDGS--LPATPDPKELG-------------------------------
                             .       ...                                  

A0A8C2A7Q5_MCL1-04      RKSVRQSTTEHTRLTYLRLQERQVAPRRRKGTRHERPLTQAELLAEAKVT
A0A8C2A7Q5_MCL1-02      --------------------------------------VCAALEMDTREI
A0A8C1JUN1_MCL1-01      --------------------------------------VCAALEMDTREI
A0A8C2A7Q5_MCL1-03      --------------------------------------VCAALEMDTREI
A0A8C2A7Q5_MCL1-01      --------------------------------------VCAALEMDTREI
A0A8C1Y6A5_MCL1-01      --------------------------------------IYDALEMDTREI
A0A8C2BAP8_MCL1-02      ---------------------------------------SVELHLDTRQL
A0A8C2BAP8_MCL1-01      ---------------------------------------SVELHLDTRQL
A0A8C1JUN1_MCL1-02      --------------------------------------VCAALEMDTREI
A0A8C1PPB3_MCL1-01      ---------------------------------------SAELGRDTRRL
A0A8C1X8V5_MCL1-01      ---------------------------------------SAELGRDTRRL
A0A8C1YDY0_MCL1-01      ---------------------------------------SVELHLDTRQL
                                                                  *  :::  

A0A8C2A7Q5_MCL1-04      AQINLRSLENYERLEADKKRQVHMKRQCVGS-VIRYHSVLMPLVSDVTLK
A0A8C2A7Q5_MCL1-02      IDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLE
A0A8C1JUN1_MCL1-01      IDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLE
A0A8C2A7Q5_MCL1-03      IDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLE
A0A8C2A7Q5_MCL1-01      IDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLE
A0A8C1Y6A5_MCL1-01      IDIFLKNFNGLPHSKRGNKQVLETMNRVVESLVVKHELAYKGMIARLNLE
A0A8C2BAP8_MCL1-02      MLDFYRTHTGMCPPDRKRHHALPTMRRVVADILIKHQITYKGMLQRLQLD
A0A8C2BAP8_MCL1-01      MLDFYRTHTGMCPPDRKRHHALPTMRRVVADILIKHQITYKGMLQRLQLD
A0A8C1JUN1_MCL1-02      IDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHELAYKGMIARLNLE
A0A8C1PPB3_MCL1-01      LLDFYRTHTGLCPRDRKQHHALPTMTRVVADILLKHEIAYKGMLQRLQLD
A0A8C1X8V5_MCL1-01      LLDFYRTHTGLCPRDRKQHHALPTMTRVVADILLKHEIAYKGMLQRLQLD
A0A8C1YDY0_MCL1-01      MLDFYRTHTGMCPPDRKRHHALPTMRRVVADILIKHQITYKGMLQRLQLD
                             :.  .    .  .:: :    : * . ::::. .   ::  : *.

A0A8C2A7Q5_MCL1-04      EENVDVEGLDQDAQQ-------NPGP------------------------
A0A8C2A7Q5_MCL1-02      EKGEDVSFVKTVATELFSDGITNWGRIASLLTFGAIVCKHQNDRGLSKCV
A0A8C1JUN1_MCL1-01      EKGEDVSFVKTVATELFSDGITNWGRIASLLTFGAIVCKHQNDRGLSKCV
A0A8C2A7Q5_MCL1-03      EKGEDVSFVKTVATELFSDGITNWGRIASLLTFGAIVCKHQNDRGLSKCV
A0A8C2A7Q5_MCL1-01      EKGEDVSFVKTVATELFSDGITNWGRIASLLTFGAIVCKHQNDRGLSKCV
A0A8C1Y6A5_MCL1-01      QKGEDVSFVKTVATELFSDGITNWGRIASLLTFGAMVCKHQKDKGLTNCV
A0A8C2BAP8_MCL1-02      SQPDDMSFISCIAKTMFKDHTTNWGRIVSLVAFGAVVCTQLKELQRERCV
A0A8C2BAP8_MCL1-01      SQPDDMSFISCIAKTMFKDHTTNWGRIVSLVAFGAVVCTQLKELQRERCV
A0A8C1JUN1_MCL1-02      EKGEDVSFVKTVATELFSDGITNWGRIASLLTFGAIVCKHQNDRGLSKCV
A0A8C1PPB3_MCL1-01      SQPDDMSFISCIAKTMFKDHTTNWGRIVSLVAFGAVVCTHLKELQRERCV
A0A8C1X8V5_MCL1-01      SQPDDMSFISCIAKTMFKDHTTNWGRIVSLVAFGAVVCTQLKELQRERCV
A0A8C1YDY0_MCL1-01      SQPDDMSFISCIAKTMFKDHTTNWGRIVSLVAFGAVVCTQLKELQREQCV
                        .:  *:. :.  *         * *                         

A0A8C2A7Q5_MCL1-04      ------HPSQALSQSESTLTAPPSVFSSNTAAVNPSLSS-----------
A0A8C2A7Q5_MCL1-02      SLVGEEISSYLLTDQRHWLLKNKAWDGF------------------EEFF
A0A8C1JUN1_MCL1-01      SLVGEEISSYLLTDQRHWLLKNKAWDGF------------------EEFF
A0A8C2A7Q5_MCL1-03      SLVGEEISSYLLTDQRHWLLKNKAWDGF------------------EEFF
A0A8C2A7Q5_MCL1-01      SLVGEEISSYLLTDQRHWLLKNKAWDGF------------------EEFF
A0A8C1Y6A5_MCL1-01      SLVGKEISNYLLTAQRDWLLKNKAWDGF------------------VEFF
A0A8C2BAP8_MCL1-02      EAVAEQISSYLISEQHDWLLNNKSWVSDHT-LVFPSLRNSEPFCVCVESS
A0A8C2BAP8_MCL1-01      EAVAEQISSYLISEQHDWLLNNKSWHGF------------------VEFF
A0A8C1JUN1_MCL1-02      SLVGEEISSYLLTDQRHWLLKNKAWDGF------------------EEFF
A0A8C1PPB3_MCL1-01      ETVAEQISSYLISEQHDWLLNNKSWHGF------------------VEFF
A0A8C1X8V5_MCL1-01      EAVAEQISSYLISEQHDWLLNNKSWHGF------------------VEFF
A0A8C1YDY0_MCL1-01      EAVAEQISSYLISEQHDWLLNNKSWHGF------------------VEFF
                               ..  :: ..  *    :  .                       

A0A8C2A7Q5_MCL1-04      --------------------------------------------------
A0A8C2A7Q5_MCL1-02      HVPDTEGAVRNALMAIGSFATFGAALAYLIRPSVGSNEDYGNDTHRASPD
A0A8C1JUN1_MCL1-01      HVPDTEGAVRNALMAIGSFATFGAALAYLIRPSVGSNEDYGNDTHRASPD
A0A8C2A7Q5_MCL1-03      HVPDTEGAVRNALMAIGSFATFGAALAYLIRPSVGSNEDYGNDTHRASPD
A0A8C2A7Q5_MCL1-01      HVPDTEGAVRNALMAIGSFATFGAALAYLIRPSVGSNEDYGNDTHRASPD
A0A8C1Y6A5_MCL1-01      RVPDTEGAVRNALMAIGSVATFGAALAYLIR-------------------
A0A8C2BAP8_MCL1-02      PFNTRETCIRPPEKPLLN-----SPTSSSAP-------------------
A0A8C2BAP8_MCL1-01      RVEDVESVVRSALMAVVGCAGIGAGLALLIR-------------------
A0A8C1JUN1_MCL1-02      HVPDTEGAVRNALMAIGSFATFGAALAYLIR-------------------
A0A8C1PPB3_MCL1-01      RVEDVESVVRNALMAVVGCAGIGAGLAFLIR-------------------
A0A8C1X8V5_MCL1-01      RVEDVESVVRNALMAVVGCAGIGAGLAFLIR-------------------
A0A8C1YDY0_MCL1-01      RVEDVESVVRSALMAVVGCAGIGAGLALLIR-------------------
                                                                          

A0A8C2A7Q5_MCL1-04      GPAKCSRTYITFSDD---ESLQRFFPQSPPP--------RIPVQEICPV-
A0A8C2A7Q5_MCL1-02      PPAHCGSTCCGYLSQAVKLSGIQGLISEPSP--------QESVSFSVTAL
A0A8C1JUN1_MCL1-01      PPAHCGSTCCGYLSQAVKLSGIQVKPCDNTC--------TN---------
A0A8C2A7Q5_MCL1-03      PPAHCGSTCCGYLSQAVKLSGIQEKRSHDVS--------ER---------
A0A8C2A7Q5_MCL1-01      PPAHCGSTCCGYLSQAVKLSGIQESGDEEYKGDLSETEDEVDSDFDIDEG
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
                                                                          

A0A8C2A7Q5_MCL1-04      -----THKPA--LYRDPITDIPYANVQAFRIIREAYKK------------
A0A8C2A7Q5_MCL1-02      EKMVCMHFWT--SRHANVQNNDHGMLLAFLINTVAYLNFFRVSLFFLFCF
A0A8C1JUN1_MCL1-01      --------------------------------------------------
A0A8C2A7Q5_MCL1-03      --------WAGHLRHHVRQNRS----------------------------
A0A8C2A7Q5_MCL1-01      -------------DEPDSEQEEDGPRRKSRVVTKAYKEPVKVVRQ-----
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
                                                                          

A0A8C2A7Q5_MCL1-04      ---YVAAHGLPSTGTVTPADTTAKNLRQ-------------------KII
A0A8C2A7Q5_MCL1-02      LTKCYAQMSLPGI----------KMIIK-------------------LMI
A0A8C1JUN1_MCL1-01      ------------------------------------------------LH
A0A8C2A7Q5_MCL1-03      ---K----------------------------------------------
A0A8C2A7Q5_MCL1-01      KPKQRKLAELPRR----------TVKTKINKYNPPELQEDINKSETFALY
A0A8C1Y6A5_MCL1-01      --------------------------------------------------
A0A8C2BAP8_MCL1-02      --------------------------------------------------
A0A8C2BAP8_MCL1-01      --------------------------------------------------
A0A8C1JUN1_MCL1-02      --------------------------------------------------
A0A8C1PPB3_MCL1-01      --------------------------------------------------
A0A8C1X8V5_MCL1-01      --------------------------------------------------
A0A8C1YDY0_MCL1-01      --------------------------------------------------
                                                                          

A0A8C2A7Q5_MCL1-04      IKQGM
A0A8C2A7Q5_MCL1-02      FSKNI
A0A8C1JUN1_MCL1-01      ILVLW
A0A8C2A7Q5_MCL1-03      HKFGL
A0A8C2A7Q5_MCL1-01      LHMHM
A0A8C1Y6A5_MCL1-01      -----
A0A8C2BAP8_MCL1-02      -----
A0A8C2BAP8_MCL1-01      -----
A0A8C1JUN1_MCL1-02      -----
A0A8C1PPB3_MCL1-01      -----
A0A8C1X8V5_MCL1-01      -----
A0A8C1YDY0_MCL1-01      -----
                             

© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice