Dataset for protein Mcl-1 of organism Cyprinus carpio

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C1YDY0_MCL1-01      ---------MTLSFGIKRTAALSVFAQGAHTSLVPGPALKPRTEDELDGY
A0A8C1JUN1_MCL1-02      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAG-
A0A8C1JUN1_MCL1-01      MFPGSKVSNDNGLWPCIGIAALNVNNSSSGFGRKPLVMPEPKAQNEFAG-
                                  .  :     ***.*  ..:  .  *    :*.:::*: * 

A0A8C1YDY0_MCL1-01      ADDTEAALKPPRPGTNGLKGLQLDGRFVSAGDGSLPATPDPKELGSVE--
A0A8C1JUN1_MCL1-02      ---------------NGLQ-------------GSVPSSPESDCEEIVDYS
A0A8C1JUN1_MCL1-01      ---------------NGLQ-------------GSVPSSPESDCEEIVDYS
                                       ***:             **:*::*:..    *:  

A0A8C1YDY0_MCL1-01      -----LHLDTRQLMLDFYRTHTGMCPPDRKRHHALPTMRRVVADILIKHQ
A0A8C1JUN1_MCL1-02      PVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHE
A0A8C1JUN1_MCL1-01      PVCAALEMDTREIIDIFLKSFTGLPHSKSGKKQILSTMKRVVDSLVVKHE
                             * :***:::  * .:.**:  ..  .:: *.**.*** .:::**:

A0A8C1YDY0_MCL1-01      ITYKGMLQRLQLDSQPDDMSFISCIAKTMFKDHTTNWGRIVSLVAFGAVV
A0A8C1JUN1_MCL1-02      LAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASLLTFGAIV
A0A8C1JUN1_MCL1-01      LAYKGMIARLNLEEKGEDVSFVKTVATELFSDGITNWGRIASLLTFGAIV
                        ::****: **:*:.: :*:**:. :*. :*.*  ******.**::***:*

A0A8C1YDY0_MCL1-01      CTQLKELQREQCVEAVAEQISSYLISEQHDWLLNNKSWHGFVEFFRVEDV
A0A8C1JUN1_MCL1-02      CKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDT
A0A8C1JUN1_MCL1-01      CKHQNDRGLSKCVSLVGEEISSYLLTDQRHWLLKNKAWDGFEEFFHVPDT
                        *.: ::   .:**. *.*:*****:::*. ***:**:* ** ***.* *.

A0A8C1YDY0_MCL1-01      ESVVRSALMAVVGCAGIGAGLALLIR------------------------
A0A8C1JUN1_MCL1-02      EGAVRNALMAIGSFATFGAALAYLIR------------------------
A0A8C1JUN1_MCL1-01      EGAVRNALMAIGSFATFGAALAYLIRPSVGSNEDYGNDTHRASPDPPAHC
                        *..**.****: . * :**.** ***                        

A0A8C1YDY0_MCL1-01      -----------------------------------
A0A8C1JUN1_MCL1-02      -----------------------------------
A0A8C1JUN1_MCL1-01      GSTCCGYLSQAVKLSGIQVKPCDNTCTNLHILVLW
                                                           

© 1998-2023Legal notice