Dataset for protein BCL-2-like of organism Cyanistes caeruleus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    :                                                           
-------------------mlvvdy-------------------------------------------------------
qrnifiaqamptrryyynreigtsfvsyklsqrgyswsqleerdpnstglsapaaaagtssemtgvvspspswhaptshi
         hegamgssvyy cqplihk    k  d aag deaelrpdf        eeddhd llngh e        
             ef d    alk af                                                     
                      i                                                         

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  .        *     :. .    :  :  .      :. .     *    * ** .****::
------rqyvlqesqlgpaqtrvahvlRtigsslqdryeralrplldqlhitsvtvakr-fngVvdelFrDG-tNWGRiv
vpgavvlsssspvhssrrgpq-hrrss qaadefsrqtremfsqmtsridldpsaays-i--- mnhk a  nv    vm
pnrstkhghcpfregi g ldv pqa  gvlvl npnlqgd ak si qee lqs vqs  vq ae   s  v       
eg  aaae a ea e    a p hl   e     el  p    d eg      f  re   ea  a              
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
::: **. :             :    :. :   :*  :      *:: :***   .                    . *
tiftFGglltkklv------taemkelisyi---iTeylinnkaeWiqanGGWe-gfvdkfe--------r------rsL
afis  avvcvesqehgvqlvrkesvevksfaswm taivshlrp ldsq   vnshlt---vedlegvr-gqetfnnw 
 l e   fma h k      sk qrqs drlvgi   trs hh  ee      r p lyrndaaaesik      kv 
   a   a            ni  ep   n  a      nd  d    d          f g                  
                                                                                

       250       260 
....:....|....:....|.
   :   .             
lsfakvtglliavvslfre--
ptpstiaawwlprsyssp-yy
mlg par vgdllllmi k  
 a  g     aggag a    
                     
© 1998-2022Legal notice