Dataset for protein BCL-2-like of organism Cyanistes caeruleus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0U194_BCL2L1-      -------------MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDF
A0A8C0UAC7_BCL2-01      QRNIFIAQAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLSPGL
A0A8C0UPM3_BCL2A1-      -------------------MLGVPFAFK----------------------
A0A8C0UE15_MCL1-01      -------------------MLCTSL-------------------------
A0A8C0UPM3_BCL2A1-      ---------METAEFYYVYYLAQDY-------------------------
                                            :                             

A0A8C0U194_BCL2L1-      ------AGEEDEMDGVLNGSPSWHAPTSHIVNGATVHQSSLEVHEIRRAA
A0A8C0UAC7_BCL2-01      SAPAAAAGTSSDHTGLVSPHPE--------PPGSAAASHAPPAEGLRPAP
A0A8C0UPM3_BCL2A1-      ------------------------------EGRAVKREYVLQESQLGPAQ
A0A8C0UE15_MCL1-01      ------------------------------------RGSCSFRSSSGGGL
A0A8C0UPM3_BCL2A1-      ------------------------------------LQYVLQESQLGPAQ
                                                                        . 

A0A8C0U194_BCL2L1-      D-VRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQS-FEQVVNELFR
A0A8C0UAC7_BCL2-01      QVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSR-FVAVVEELFR
A0A8C0UPM3_BCL2A1-      TRVAHVLRTIASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFA
A0A8C0UE15_MCL1-01      TPHPRSSRGVLVLLNPNLPGMLRKLEIQQEEDLQSVVE-----VAAHLFS
A0A8C0UPM3_BCL2A1-      TRVAHVLRTIASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFA
                               *     :. .    :  :  .      :. .     *    * 

A0A8C0U194_BCL2L1-      DG-VNWGRIVAFFSFGGALCVESV------VKEMRVLVKRIVSWMTTYLT
A0A8C0UAC7_BCL2-01      DG-VNWGRIVAFFEFGGVMCVESV------NREMSPLVDNIAAWMTEYLN
A0A8C0UPM3_BCL2A1-      DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYF---ITEYII
A0A8C0UE15_MCL1-01      DGVTNWGRVVTLIAFGAFVAKHLK------SIKQEQSISSLAGIITDALV
A0A8C0UPM3_BCL2A1-      DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYF---ITEYII
                        ** .****::::: **. :             :    :. :   :*  : 

A0A8C0U194_BCL2L1-      DHLDPWIQENGGWE-RFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVL
A0A8C0UAC7_BCL2-01      RHLHHWIQDNGGWV-SHPD------------------RSLPLPAPARGWW
A0A8C0UPM3_BCL2A1-      NNKAEWIDANGGWENGFLTKFE--------R------RSLLSFSKITALL
A0A8C0UE15_MCL1-01      SSKREWLESQGGWE-GFVDFFRVEDLEGSIR------NVLMAFAGVAGLG
A0A8C0UPM3_BCL2A1-      NNKAEWIDANGGWENGFLTKFE--------R------RSLLSFSKITALL
                             *:: :***   .                    . *   :   .  

A0A8C0U194_BCL2L1-      LLGSLLSRK--
A0A8C0UAC7_BCL2-01      DPRLGSAPE--
A0A8C0UPM3_BCL2A1-      IAVVSLFREYY
A0A8C0UE15_MCL1-01      AGLAYMIR---
A0A8C0UPM3_BCL2A1-      IAVVSLFREYY
                                   

© 1998-2022Legal notice