Dataset for protein BCL-2-like of organism Cyanistes caeruleus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C0U194_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cyanistes caeruleus GN=BCL2L1 (length=230 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAPTSHIVNGATVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8C0UAC7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cyanistes caeruleus GN=BCL-2 (length=224 residues).
QRNIFIAQAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLSPGLSAPAAAAGTSSDHTGLVSPHPEPPGSAAAS
HAPPAEGLRPAPQVVHLVLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMC
VESVNREMSPLVDNIAAWMTEYLNRHLHHWIQDNGGWVSHPDRSLPLPAPARGWWDPRLGSAPE
>gnl|bcl2dbpro|A0A8C0UE15_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cyanistes caeruleus GN=MCL-1 (length=160 residues).
MLCTSLRGSCSFRSSSGGGLTPHPRSSRGVLVLLNPNLPGMLRKLEIQQEEDLQSVVEVAAHLFSDGVTNWGRVVTLIAF
GAFVAKHLKSIKQEQSISSLAGIITDALVSSKREWLESQGGWEGFVDFFRVEDLEGSIRNVLMAFAGVAGLGAGLAYMIR
>gnl|bcl2dbpro|A0A8C0UPM3_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Cyanistes caeruleus GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESQLGPAQTRVAHVLRTIASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
ALLIAVVSLFREYY
>gnl|bcl2dbpro|A0A8C0UPM3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cyanistes caeruleus GN=BCL2A1 (length=173 residues).
MLGVPFAFKEGRAVKREYVLQESQLGPAQTRVAHVLRTIASSLQDQTEEALRPLLDRIDITSVAVAKRIFNGVMDEKFAD
GNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKITA
LLIAVVSLFREYY
© 1998-2022Legal notice