Dataset for protein BCL-2-like of organism Crocodylus porosus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            :   
-------------------------------------------------------------hstqnsypnrelvlpyiky
meagrlfqpkrihvrtrmsqtdrphrdkpyryyeshgydrhntdrrtkepypshgrsakmt----tgrysclisdkfkhn
                                                           esstvtrfssv cc qd ls 
                                                            anpsrm ch     i     
                                                             megke  d           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :.                                                                     *    . :
klsqrgyvwsspqfyppkqtssspcanvastrtsskfvgptvshl-pigvaaasnvpsgytsgpalqmvsltLrtagspf
avqth--dsaahhdra--p-f-eka-aicaaggild--eivsli-mlacs---qtaip-nepiggpgaghfs dqiyddl
v  e- h---------wt-p-l---e----------sw------ve---- gh-----asqlv vas- rqv  n a s 
       s  qlegqdrgrlehaee dm  vpng pnthl a  r vn a   r nle qd     er aha  e   e 
                ec   f              ha      p                                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.      .  :   : ::    *   :  :  .    .  .   ::                  ::  :.*         
egryqsevrdl--qlhftpmt-Arrvfgqvveelfrdg-vnwgriv------------------affifgGvmcvesvnl
sryelkdfaqmsgdmqlsqfrv pcryvgiafsetmaanltllfllvgakqihrlsmpllvaectidsla mayisaqgr
qletrrnlspftst esie  yqs ta mnq  a   t                           m   ivtkrn eq
 k  eea  ld      g    gi                                       g   al   l dk
 c                                                               e           h

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :             :       *             * :             : ::.                      
emypl---vqvittwmte-----YlrrhltswiqengGwd-----------afvelygnvarcly------------ips
ylsfvgenidnnaydvckrrerl anngyqnmncdvq gengflmkfegqksalavfdinmapmirrgdfswiswktfl-
gvqvt   kgr ssfimt      itdnkdp  ea                rwis   vk  lks   qerfnk   --t
   l     eq i            m   ae                       d   dd  i a     f      li 
                                                              a                 

       330       340       350       360       370    
....:....|....:....|....:....|....:....|....:....|....
             : .                                      
svlvartitlgsylsrk-------------------------------------
l-icgac-rtvrnfrhhqtqpqyspessyrerghhkanrspestrsmqavatlv
-a-----l-vfal gqyy                                    
g t  gv l   f                                         
                                                      
© 1998-2021Legal notice