Dataset for protein BCL-2-like of organism Crocodylus porosus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A7M4EJG9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Crocodylus porosus GN=BCL2L1 (length=229 residues).
MSSSNRELVIDFISYKLSQRGHSWSQLEGQDETRTEFAEEEDMASVPNGSPSWHPTASHVVNGAAGHRNNLEAQESVPAA
EVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVG
RIISWMTTYLTDHLDPWIQENGGWERFVDLYGDDAAAKSRRGQERFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A7M4EPU7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Crocodylus porosus GN=BCL-2 (length=236 residues).
MSSTVKTGYHNREIVLKYIHYKLSQRGYDWAAHQDRAWCPLSLSPAAAVAAAGTSSDNTGLVSLHREPAGSAAASNVPPG
NDLGPVLQAVHLTLRQAGDDFSCRYQSDVAQMSGQLHLTPFTARRRFMAVVEELFRDGVNWGRIVAFFGFGGVMCVENVN
QEMSPLVDNIATWMMEYLNRHLQNWIQDNGGWDAFIELYGNNMRLLIDFFWISWKTIISLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A7M4FFQ8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Crocodylus porosus GN=BCL2A1 (length=175 residues).
MESTEFCYVCCLVQDYLKYVLQESQPGPAPSRVAHVLRNIASSLQKETEENLKPFLDTLEFSSIEVARRIFTQVMEQEFA
DGNTNWGRILTIFMFGGIVTKRLQEHGVQLTGENKEQISYFITEYIMNNKAEWIEANGGWENGFLMKFEGQKSWLSLFDV
KARIMAVFSFFSQYY
>gnl|bcl2dbpro|A0A7M4G2E0_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Crocodylus porosus GN=BCL-2 (length=236 residues).
MANPGRRGYDNREIVLKYIHYKLSQRGYDWAAHQDRARGPPSHSPAAAVAAAGTSSDHAGPVSLHPEPAGSAAASNVPPG
NEPGPAPQAVHLTLRQAGDDFSRRYQSDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIATWMTEYLNRHLQNWIQDNGGWDAFVELYGNNMRPLIDFSWISWKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A7M4G2E0_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Crocodylus porosus GN=BCL-2 (length=292 residues).
MEAGSAKETHSTQNSRPSRLCSDPYKKNAVSTHGYVSSSPHFYPPKQTFSEKCANICSTRGILKFVEITVSILMLICVAA
AQTAISGYTSIGGLGMGSFSLDTAYSPFEGYELKEVRDLDMQFSQMRAPCVYGGIAFSLTMAALTLLFLVVGAKQIHRLS
MPLLVAECAFDILAGMAYISAVGLYLYFVIQVNTTDVCKRRERLYARRGYTSMNCEVQGGDAAVAVFGIVAACLYFPSSV
ICARTIRTVRNFRRHQTQPQYSPESSYRERGHHKANRSPESTRSMQAVATLV
>gnl|bcl2dbpro|A0A7M4G2E0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Crocodylus porosus GN=BCL-2 (length=344 residues).
MEAGRLFQPKRIHVRTRMSQTDRPHRDKPYRYYESHGYDRHNTDRRTKEPYPSHGRSAKETHSTQNSRPSRLCSDPYKKN
AVSTHGYVSSSPHFYPPKQTFSEKCANICSTRGILKFVEITVSILMLICVAAAQTAISGYTSIGGLGMGSFSLDTAYSPF
EGYELKEVRDLDMQFSQMRAPCVYGGIAFSLTMAALTLLFLVVGAKQIHRLSMPLLVAECAFDILAGMAYISAVGLYLYF
VIQVNTTDVCKRRERLYARRGYTSMNCEVQGGDAAVAVFGIVAACLYFPSSVICARTIRTVRNFRRHQTQPQYSPESSYR
ERGHHKANRSPESTRSMQAVATLV
© 1998-2021Legal notice