Dataset for protein BCL-2-like of organism Crocodylus porosus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7M4FFQ8_BCL2A1-      --------------------------------------------------
A0A7M4G2E0_BCL2-02      MEAG----------------------------------------------
A0A7M4G2E0_BCL2-01      MEAGRLFQPKRIHVRTRMSQTDRPHRDKPYRYYESHGYDRHNTDRRTKEP
A0A7M4EJG9_BCL2L1-      --------------------------------------------------
A0A7M4EPU7_BCL2-01      --------------------------------------------------
A0A7M4G2E0_BCL2-03      --------------------------------------------------
                                                                          

A0A7M4FFQ8_BCL2A1-      -----------MESTEFCYVCCLVQDYLKYVLQE----------------
A0A7M4G2E0_BCL2-02      ------SAKETHSTQNSRPSRLCSDPYKKNAVSTHGYVSSSPHFYPPKQT
A0A7M4G2E0_BCL2-01      YPSHGRSAKETHSTQNSRPSRLCSDPYKKNAVSTHGYVSSSPHFYPPKQT
A0A7M4EJG9_BCL2L1-      ---------------MSSSNRELVIDFISYKLSQRGHSWSQLEGQDETRT
A0A7M4EPU7_BCL2-01      ---------MSSTVKTGYHNREIVLKYIHYKLSQRGYDWAAHQDRAWCPL
A0A7M4G2E0_BCL2-03      ---------MANPGRRGYDNREIVLKYIHYKLSQRGYDWAAHQDRARGPP
                                                  :    :.                 

A0A7M4FFQ8_BCL2A1-      ---------------------------------------SQPGPAPSRVA
A0A7M4G2E0_BCL2-02      FSEKCANICSTRGILKFVEITVSILMLICVAAAQTAISGYTSIGGLGMGS
A0A7M4G2E0_BCL2-01      FSEKCANICSTRGILKFVEITVSILMLICVAAAQTAISGYTSIGGLGMGS
A0A7M4EJG9_BCL2L1-      EFAEEEDMASVPNGSPSWHPTASHV-VNGAAGHRNNLEAQESVPAAE-VR
A0A7M4EPU7_BCL2-01      SLSPAAAVAAAGTSSDNTGLVSLHREPAGSAAASNVPPGNDLGPVLQAVH
A0A7M4G2E0_BCL2-03      SHSPAAAVAAAGTSSDHAGPVSLHPEPAGSAAASNVPPGNEPGPAPQAVH
                                                                          

A0A7M4FFQ8_BCL2A1-      HVLRNIASSLQKETEENLKPFLDTLEFSSIEVARRIFTQVMEQEFADGNT
A0A7M4G2E0_BCL2-02      FSLDTAYSPFEGYELKEVRDL--DMQFSQMR-APCVYGGIAFSLTMAA-L
A0A7M4G2E0_BCL2-01      FSLDTAYSPFEGYELKEVRDL--DMQFSQMR-APCVYGGIAFSLTMAA-L
A0A7M4EJG9_BCL2L1-      QALREAGDEFELRYRRAFSDLTSQLHITPGT-AYQSFEQVVNELFRDG-V
A0A7M4EPU7_BCL2-01      LTLRQAGDDFSCRYQSDVAQMSGQLHLTPFT-ARRRFMAVVEELFRDG-V
A0A7M4G2E0_BCL2-03      LTLRQAGDDFSRRYQSDFAQMSGQLHLTPFT-ARGRFVAVVEELFRDG-V
                          *    . :.      .  :   : ::    *   :  :  .    .  

A0A7M4FFQ8_BCL2A1-      NWGRIL------------------TIFMFGGIVTKRLQEHGVQLTGENKE
A0A7M4G2E0_BCL2-02      TLLFLVVGAKQIHRLSMPLLVAECAFDILAGMAYISAVGLYLYFV---IQ
A0A7M4G2E0_BCL2-01      TLLFLVVGAKQIHRLSMPLLVAECAFDILAGMAYISAVGLYLYFV---IQ
A0A7M4EJG9_BCL2L1-      NWGRIV------------------AFFSFGGALCVESVDKEMQVL---VG
A0A7M4EPU7_BCL2-01      NWGRIV------------------AFFGFGGVMCVENVNQEMSPL---VD
A0A7M4G2E0_BCL2-03      NWGRIV------------------AFFEFGGVMCVESVNREMSPL---VD
                        .   ::                  ::  :.*          :        

A0A7M4FFQ8_BCL2A1-      QISYFITE-----YIMNNKAEWIEANGGWENGFLMKFEGQKSWLSLFDVK
A0A7M4G2E0_BCL2-02      VNTTDVCKRRERLYARRGYTSMNCEVQGGD-----------AAVAVFGIV
A0A7M4G2E0_BCL2-01      VNTTDVCKRRERLYARRGYTSMNCEVQGGD-----------AAVAVFGIV
A0A7M4EJG9_BCL2L1-      RIISWMTT-----YLTDHLDPWIQENGGWE-----------RFVDLYGDD
A0A7M4EPU7_BCL2-01      NIATWMME-----YLNRHLQNWIQDNGGWD-----------AFIELYGNN
A0A7M4G2E0_BCL2-03      NIATWMTE-----YLNRHLQNWIQDNGGWD-----------AFVELYGNN
                             :       *             * :             : ::.  

A0A7M4FFQ8_BCL2A1-      ARIMA------------------------VFSFFSQYY------------
A0A7M4G2E0_BCL2-02      AACLY------------FPSSVICARTIRTVRNFRRHQTQPQYSPESSYR
A0A7M4G2E0_BCL2-01      AACLY------------FPSSVICARTIRTVRNFRRHQTQPQYSPESSYR
A0A7M4EJG9_BCL2L1-      AAAKSRRGQERFNKW--LLTGATVAGVLLLGSLLSRK-------------
A0A7M4EPU7_BCL2-01      MRLLI---DFFWISWKTIISLVLVGACITLGAYLGHK-------------
A0A7M4G2E0_BCL2-03      MRPLI---DFSWISWKTILSLVLVGACITLGAYLGHK-------------
                                                         : .              

A0A7M4FFQ8_BCL2A1-      ------------------------
A0A7M4G2E0_BCL2-02      ERGHHKANRSPESTRSMQAVATLV
A0A7M4G2E0_BCL2-01      ERGHHKANRSPESTRSMQAVATLV
A0A7M4EJG9_BCL2L1-      ------------------------
A0A7M4EPU7_BCL2-01      ------------------------
A0A7M4G2E0_BCL2-03      ------------------------
                                                

© 1998-2021Legal notice