Dataset for protein Bcl-2 of organism Crocodylus porosus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            : . . .  .*     * : 
-----------------------------------------------------------mthstqnsypsRlivlpYkky
meagrlfqpkrihvrtrmsqtdrphrdkpyryyeshgydrhntdrrtkepypshgrsakesstvrtgrhn ecsdk ihn
                                                            anpgkr  d           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :* .**   . ..    * . : :   *   :: .    *.:  .       ***... .*           ::*  * 
kvStrGY---vsssrhfyPpsqtpsekvAnigttsgilkfVsltvs---pigvAAAstvpsGytsipglqmvsltLrtAy
al qh  dwaahqdpawg lklsfaaac aacssrdntgp eihreilmlacs   qnaip nepggvpgaghfs dq g
                rc   h              ha l    p                  dl  a            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
. *.    .:. ::  ::::: : *   : .:. .*   .:.   :*                  **  :.*:  :. *.
spFsgyyqsevrqm--qmqltqmtArcvyggvvfsLtrdgvtwlrlV------------------AFfilgGvmyvsaVn
dd errelkdfadlsgdlhfspfr prrfvaiaee fmaalnlgfi vgakqihrlsmpllvaec  dgfa macies g
    c                     g  m                                      e        n  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :  :::  :* : :     * .*   .   :  * ** : ::*                     :*.**: : : :  
lymypvvqvntTwvck-----YlrRhytswnqevqGwDAfvevyG---------------------lVgAClylpsyv--
relsflidnia dmterrerl an glqnmicdng g  aialf nnmrplidfswiswktilslvi a  itfgaslic
            m                                  l    f       i                 

       330       340       350       360       370
....:....|....:....|....:....|....:....|....:....|
                            **:                   
----------------------------GHk-------------------
artirtvrnfrrhqtqpqyspessyrer  hkanrspestrsmqavatlv
                                                  
© 1998-2021Legal notice