Dataset for protein Bcl-2 of organism Crocodylus porosus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A7M4EPU7_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Crocodylus porosus GN=BCL-2 (length=236 residues).
MSSTVKTGYHNREIVLKYIHYKLSQRGYDWAAHQDRAWCPLSLSPAAAVAAAGTSSDNTGLVSLHREPAGSAAASNVPPG
NDLGPVLQAVHLTLRQAGDDFSCRYQSDVAQMSGQLHLTPFTARRRFMAVVEELFRDGVNWGRIVAFFGFGGVMCVENVN
QEMSPLVDNIATWMMEYLNRHLQNWIQDNGGWDAFIELYGNNMRLLIDFFWISWKTIISLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A7M4G2E0_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Crocodylus porosus GN=BCL-2 (length=236 residues).
MANPGRRGYDNREIVLKYIHYKLSQRGYDWAAHQDRARGPPSHSPAAAVAAAGTSSDHAGPVSLHPEPAGSAAASNVPPG
NEPGPAPQAVHLTLRQAGDDFSRRYQSDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIATWMTEYLNRHLQNWIQDNGGWDAFVELYGNNMRPLIDFSWISWKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A7M4G2E0_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Crocodylus porosus GN=BCL-2 (length=292 residues).
MEAGSAKETHSTQNSRPSRLCSDPYKKNAVSTHGYVSSSPHFYPPKQTFSEKCANICSTRGILKFVEITVSILMLICVAA
AQTAISGYTSIGGLGMGSFSLDTAYSPFEGYELKEVRDLDMQFSQMRAPCVYGGIAFSLTMAALTLLFLVVGAKQIHRLS
MPLLVAECAFDILAGMAYISAVGLYLYFVIQVNTTDVCKRRERLYARRGYTSMNCEVQGGDAAVAVFGIVAACLYFPSSV
ICARTIRTVRNFRRHQTQPQYSPESSYRERGHHKANRSPESTRSMQAVATLV
>gnl|bcl2dbpro|A0A7M4G2E0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Crocodylus porosus GN=BCL-2 (length=344 residues).
MEAGRLFQPKRIHVRTRMSQTDRPHRDKPYRYYESHGYDRHNTDRRTKEPYPSHGRSAKETHSTQNSRPSRLCSDPYKKN
AVSTHGYVSSSPHFYPPKQTFSEKCANICSTRGILKFVEITVSILMLICVAAAQTAISGYTSIGGLGMGSFSLDTAYSPF
EGYELKEVRDLDMQFSQMRAPCVYGGIAFSLTMAALTLLFLVVGAKQIHRLSMPLLVAECAFDILAGMAYISAVGLYLYF
VIQVNTTDVCKRRERLYARRGYTSMNCEVQGGDAAVAVFGIVAACLYFPSSVICARTIRTVRNFRRHQTQPQYSPESSYR
ERGHHKANRSPESTRSMQAVATLV
© 1998-2021Legal notice