Dataset for protein Bcl-2 of organism Crocodylus porosus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7M4EPU7_BCL2-01      --------------------------------------------------
A0A7M4G2E0_BCL2-03      --------------------------------------------------
A0A7M4G2E0_BCL2-02      MEAG----------------------------------------------
A0A7M4G2E0_BCL2-01      MEAGRLFQPKRIHVRTRMSQTDRPHRDKPYRYYESHGYDRHNTDRRTKEP
                                                                          

A0A7M4EPU7_BCL2-01      ---------MSSTVKTGYHNREIVLKYIHYKLSQRGYDWAAHQDRAWCPL
A0A7M4G2E0_BCL2-03      ---------MANPGRRGYDNREIVLKYIHYKLSQRGYDWAAHQDRARGPP
A0A7M4G2E0_BCL2-02      ------SAKETHSTQNSRPSRLCSDPYKKNAVSTHGY---VSSSPHFYPP
A0A7M4G2E0_BCL2-01      YPSHGRSAKETHSTQNSRPSRLCSDPYKKNAVSTHGY---VSSSPHFYPP
                                  : . . .  .*     * :  :* .**   . ..    * 

A0A7M4EPU7_BCL2-01      SLSPAAAVAAAGTSSDNTGLVSLHRE---PAGSAAASNVPPGNDLGPVLQ
A0A7M4G2E0_BCL2-03      SHSPAAAVAAAGTSSDHAGPVSLHPE---PAGSAAASNVPPGNEPGPAPQ
A0A7M4G2E0_BCL2-02      KQTFSEKCANICSTRGILKFVEITVSILMLICVAAAQTAISGYTSIGGLG
A0A7M4G2E0_BCL2-01      KQTFSEKCANICSTRGILKFVEITVSILMLICVAAAQTAISGYTSIGGLG
                        . : :   *   :: .    *.:  .       ***... .*        

A0A7M4EPU7_BCL2-01      AVHLTLRQAGDDFSCRYQSDVAQMSGQLHLTPFTARRRFMAVVEELFRDG
A0A7M4G2E0_BCL2-03      AVHLTLRQAGDDFSRRYQSDFAQMSGQLHLTPFTARGRFVAVVEELFRDG
A0A7M4G2E0_BCL2-02      MGSFSLDTAYSPFEGYELKEVRDL--DMQFSQMRAPCVYGGIAFSLTMAA
A0A7M4G2E0_BCL2-01      MGSFSLDTAYSPFEGYELKEVRDL--DMQFSQMRAPCVYGGIAFSLTMAA
                           ::*  * . *.    .:. ::  ::::: : *   : .:. .*   .

A0A7M4EPU7_BCL2-01      VNWGRIV------------------AFFGFGGVMCVENVNQEMSPLVDNI
A0A7M4G2E0_BCL2-03      VNWGRIV------------------AFFEFGGVMCVESVNREMSPLVDNI
A0A7M4G2E0_BCL2-02      LTLLFLVVGAKQIHRLSMPLLVAECAFDILAGMAYISAVGLYLYFVIQVN
A0A7M4G2E0_BCL2-01      LTLLFLVVGAKQIHRLSMPLLVAECAFDILAGMAYISAVGLYLYFVIQVN
                        :.   :*                  **  :.*:  :. *.  :  :::  

A0A7M4EPU7_BCL2-01      ATWMME-----YLNRHLQNWIQDNGGWDAFIELYGNNMRLLIDFFWISWK
A0A7M4G2E0_BCL2-03      ATWMTE-----YLNRHLQNWIQDNGGWDAFVELYGNNMRPLIDFSWISWK
A0A7M4G2E0_BCL2-02      TTDVCKRRERLYARRGYTSMNCEVQGGDAAVAVFG---------------
A0A7M4G2E0_BCL2-01      TTDVCKRRERLYARRGYTSMNCEVQGGDAAVAVFG---------------
                        :* : :     * .*   .   :  * ** : ::*               

A0A7M4EPU7_BCL2-01      TIISLVLVGACITLGAYL------------------------------GH
A0A7M4G2E0_BCL2-03      TILSLVLVGACITLGAYL------------------------------GH
A0A7M4G2E0_BCL2-02      ------IVAACLYFPSSVICARTIRTVRNFRRHQTQPQYSPESSYRERGH
A0A7M4G2E0_BCL2-01      ------IVAACLYFPSSVICARTIRTVRNFRRHQTQPQYSPESSYRERGH
                              :*.**: : : :                              **

A0A7M4EPU7_BCL2-01      K-------------------
A0A7M4G2E0_BCL2-03      K-------------------
A0A7M4G2E0_BCL2-02      HKANRSPESTRSMQAVATLV
A0A7M4G2E0_BCL2-01      HKANRSPESTRSMQAVATLV
                        :                   

© 1998-2021Legal notice