Dataset for protein BCL-2-like of organism Cricetulus griseus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           .                                                    
m-q--------relvvdfssyklsqkgysw--------------------twqsesetpramtgnpswylhslpa-----
-s-sprtgydn-mitpsll-hlwlsrlfd-sqfsdveenrtgapetphvmgtelqral-stindcefmriadsaedylqy
 acagasap t -------hpmfvhc hvp lvtasdgdprergp cgif--------t---------h------eerlr
 mat        a  mkyvg   r    e  dpg   aagl  ag     sfvpa spkpsvrremkq-tsp sp     
               a  i         a                     aa a  na   lhadlaa  ra r      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                    ::         .  . .     :                ::   
-----tngstghsts-d-----------------rvvkqalrsagdefelryrryfsdld-------sqlhrtpgtarqi
vlkvpvfeaapsksyl-prrisiflsmqdevipmaalqrvasevqkdvsknlklaldhmtmvrlasp---vlsidssyts
qshllivavpaptqaqvak           iete--ihltmkrgkic it f ftsnefs       eeisil k  wnr
     cqkti egp pns                pi  dif q      r    q a  a       a   v  f  qg 
      g g    l a                  e       a      p    d                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  .  .    .  . * :  .*  *                             :        . .* :          
fnqvveelfrdg-vnwGrivafFsfGgvlcvesvqkemqvlvg---qvaswmatylnnhlapwirdnGgw----------
hetamnkeregaiist gldtv ap la-lkklaneqigpd-saykrisnfv-efimdnteelgqqs yyviahsqyqns
 tp sgda qe  p      li  agm-----d----l- -   ------v--fetrgnt  hsk             
  ed       l              a   -r  s-  d   n ql  t   drd hr   g              
                                  e          d       k   d                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
krisiflsmqdeieteeiikdifkqgkicfipryrfqsnhmdmvrlaspeeisllpktswnihqpaegdareealstggl
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          :                           .                         
----------d--------------tfve--------lygqnaevesrtlrlrfn------rwvltgdtvvg-vvllgsl
dliflpglgfekggnrlgrpksyyveylktigqiwemrcvphqaakpykgqea-keqwcsqvtfdehmmkldalptyedc
          addfmkkfeg ggwda ta         fsnsv---a---a-- dgsilpv-p--slavhav eifvnty
                                        dq tll- rdpps efn a lk-l n  laga c  a ns
                                         g le   e  gl               h         af

    
....
    
fask
psr-
lght
ad  
    
© 1998-2022Legal notice