Dataset for protein BCL-2-like of organism Cricetulus griseus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          .                                 ::  :         .     
msqs------nrelvvdflsyklsqkgyswsqfsdveenrteape-----gteseretpsalngnpswhladspa-----
----grtgydmitpslsshlwlsclrdwtpqlqtalprt------tphvmmfdcasmyihsiaedylqyvlkvsteerlr
 aca      ----------pmfvhf he -dvg sdgdprgrgp cgifsavp fsptr vrremkartsplrp     
             i mkyih        a   p    aagl  ag     a qa  nakp  ha la   ra        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        . . :                       :   :.     *  *                        *:   
-----vngatghsssldar----------evipmaavkqalreagdeFelRyrrafsdlt-------sqlhitpgTayqs
qshllfesvpsktqrvlq-visiflsmqdassvqkeieknfklylid dv ---------mvrlasp-----sid srti
     tvktiap lyqvskr         -----pv hlt  rgk c sr   fqsnhms       eeisll k  wnr
     iqa       pnp            ieteei  di  q     ip    d ae d              f   g 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  .  .   :. :. * :  .*  *                             :        . :* :          
feqvvnelfrdg-vnwGrivafFsfGgvlcvesvdkemqvlvs---riaswmatylndhlepwiqdnGgw----------
hntamekereeaiist gldtv ap la-lkklaqeqigld-gaykqvsnfv-efimnntaelgrqk yyviahsqyqns
 qp egda     l      li   gm------------ -   ------t--fdrdgnt   g              
                              nr  sp  d   n  l       k  hr                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
krisiflsmqdeieteeiikdifkqgkicfipryrfqsnhmdmvrlaspeeisllpktswnihqpaegdareealstggl
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          :              ::::                        *.                         
----------d--------------tfve--------lygnnaaaesrkgqerFn------rwfltgmtvagvvllgslf
dliflpglgfekggnrlgrpksyyvaylktigqiwemrcvqhqevkpytlala keqicpqvpvdehdmkvdeptyedcp
           ddfmkkfeg ggwd             fspsv-------rps dfswlsl----slalhlvlifantyl
                                         q tlla edpgl        ktl n  h gac    nsa

   
...
   
srk
as-
ght
d  
© 1998-2020Legal notice