Dataset for protein BCL-2-like of organism Cricetulus griseus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     :  .       
----------------------------------------------------------qt------nrelvadylsyklr
mfglrrnaviglnlycggaslgagggspagarltaeeakarregggeagllpgarvmsmsppvgydtpdvtvsferrlfs
                                                        av--drtlpydhsiltkavqfvak
                                                         mrpgcsfmri r am  im c  
                                                         aad alaee  a  e   h    
                                                           a  e a          g    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             .                                                  
qpgy-w--------------------gteseeetts----------------------------------pa--------
sk--s-vqpsdveaprteasstaaaaaimpprsppdainpnpswkrpdvppvngrtgsssslnprevismavtppsaeee
vrdllaspfeemaenasaspe pgiftfq lprelpgcegealghlaaslalleavsheaakdagaagplrs        
e   vc dvg  d aplg ap     spg gsnsve vhrdmaartsplr ivat  ptl pv       dp        
    e                     ea  a gkaa                                            
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                             . . .. .    :  :                 : 
--------------------------------------vlqtlrrvgdeferryrrafsdm-sqlhitpgtavqsftqvv
edelyrqsleiisrylreqaagvkdakplgeagaagrrlkra--saqkgvqlnhetylqglt-kmdvknedrykrnsrmm
                                      ahe-mse aeq stqlklt dsflr--ysyktsdtllmev s
                                       qlva a   d  k fhff ae sadvrlidfn rif qt e
                                                   e    d    a    g   a qg  a  a
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .        ****:* .: *.. :     . :    :     :   :   :      *:    **     :       
vel--frdgv-NWGRiVaffsFggalcvesvskemevlvsr---iaswmttylnrhlrdWiqdngGWdgfvelyg--a--
nhvlsekgiit    l tlia aayvakhlkqiqqqscigpyqqvvesiadvivdtkep lvkqr  et--hff-vq-le
daf  dse p       mvlv   vm---vsnenispdleq kllsdlvver mtrtat  rss   ae yg mhnndaa
    q  f          e   tilak adr  nl  dn    qnflc f lnqhhs  hqh    d ta   psv  
    d                            g    c     l      egn  e  ea     a      dg   
                                        a                                       

       330       340       350       360        
....:....|....:....|....:....|....:....|....:...
                                                
-sr---erf-------r--l-a-av-alvtlglyfsrk----------
egikgr---nfwwsvr-wv-t-m--v-vilafslylirtemlfiwkrl
g--  qlpldnsvtsltnltlgftggggegv taw--- a        
 ks  hplksg rll kvf slvlla c kt qilvsa          
 ak  f  eg  a f  t  g a       i af gh           
                                   af           
© 1998-2022Legal notice