Dataset for protein BCL-2-like of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9JJV8_BCL2-01        MAQAGRTGYDNREIVMKYIHYKLSQRGYEW-DVGDVDAAPLGAAPTPGIF
B2Z3Z4_BCL2L1-01      MSQS------NRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPE-----
G3HEA7_BCL2L1-02      MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE-----
G3HEA7_BCL2L1-01      MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE-----
                      *:*:      ***:*:.:: **:**.**.* :..**:     *.      

Q9JJV8_BCL2-01        SFQPESNPTPAVHRDMAARTSPLRPIVATTGPTLSPVP------PVVHLT
B2Z3Z4_BCL2L1-01      GTESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQA
G3HEA7_BCL2L1-02      GTESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQA
G3HEA7_BCL2L1-01      GTESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQA
                      . :.* :...*:: : : . :   .: .:** : *  .      ..*: :

Q9JJV8_BCL2-01        LRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGR
B2Z3Z4_BCL2L1-01      LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGR
G3HEA7_BCL2L1-02      LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGR
G3HEA7_BCL2L1-01      LREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGR
                      ** ***:*. **** *::::****:** **   *  **:***********

Q9JJV8_BCL2-01        IVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWD
B2Z3Z4_BCL2L1-01      IVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQDNGGWD
G3HEA7_BCL2L1-02      IVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQDNGGWD
G3HEA7_BCL2L1-01      IVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQDNGGWD
                      *****.***.:*****:.**. **..** **: *** ** .*********

Q9JJV8_BCL2-01        AFVELYGPSV-------RPLFDFSWLSLKTLLSLALVGACITLGTYLGHK
B2Z3Z4_BCL2L1-01      TFVELYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK
G3HEA7_BCL2L1-02      TFVELYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK
G3HEA7_BCL2L1-01      TFVELYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLFSRK
                      :****** ..       .  *:      . :*:   *.. : **: :..*

© 1998-2020Legal notice