Dataset for protein BCL-2-like of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G3GTB4_BCL2A1-01        -----------------------------MTDCEFMYIHSLAEDYLQYVL
G3HRE9_BCL2L2-01        ----------------------------MATPASAPDTRALVADFVGYKL
A0A3L7HT14_BCL2A1-      MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQYVL
A0A3L7HT14_BCL2A1-      MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQYVL
A0A3L7HT14_BCL2A1-      ---------------------------MACA----------------PML
Q9JJV8_BCL2-01          ---------------------------MAQAGRTGYDNREIVMKYIHYKL
B2Z3Z4_BCL2L1-01        ---------------------------MSQS------NRELVVDFLSYKF
G3HEA7_BCL2L1-01        ---------------------------MSQS------NRELVVDFLSYKL
                                                      :                  :

G3GTB4_BCL2A1-01        KVPTFE------------SAPSKTSRVLQRVASSVQKEVEKNLKLYLDDF
G3HRE9_BCL2L2-01        RQKGYV------CGAGPGEGPA----------------------------
A0A3L7HT14_BCL2A1-      KVPTFE------------SAPSKTSRVLQRVASSVQKEVEKNLKLYLDDF
A0A3L7HT14_BCL2A1-      KVPTFE------------SAPSKTSRVLQRVASSVQKEVEKNLKLYLDDF
A0A3L7HT14_BCL2A1-      VHRGHAPSLPTASEGDGRGRGGTCHVMAAVAASSAKRSLRAELKQRLRAL
Q9JJV8_BCL2-01          SQRGYEW-DVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPL
B2Z3Z4_BCL2L1-01        SQKGYSWSQFSDVEENRTEAPE-----GTESERETPSAINGNPSWHLADS
G3HEA7_BCL2L1-01        SQKGYSWSQFSDVEENRTEAPE-----GTESERETPSAINGNPSWHLADS
                            .                                             

G3GTB4_BCL2A1-01        DVRSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIG
G3HRE9_BCL2L2-01        --------------------------------------------------
A0A3L7HT14_BCL2A1-      DVRSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIG
A0A3L7HT14_BCL2A1-      DVRSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIG
A0A3L7HT14_BCL2A1-      SAEERLRQSHLLTQK-----------------------------------
Q9JJV8_BCL2-01          RP----------IVA-----------------------------------
B2Z3Z4_BCL2L1-01        PA----------VNG-----------------------------------
G3HEA7_BCL2L1-01        PA----------VNG-----------------------------------
                                                                          

G3GTB4_BCL2A1-01        LDVGAYKQVSNFVAEFIMNNTAEWIRQNGGW-------------------
G3HRE9_BCL2L2-01        --------------------------------------------------
A0A3L7HT14_BCL2A1-      LDVGAYKQVSNFVAEFIMNNTAEWIRQNGGW-------------------
A0A3L7HT14_BCL2A1-      LDVGAYKQVSNFVAEFIMNNTAEWIRQNGGWVIAHSQYQNSKRISIFLSM
A0A3L7HT14_BCL2A1-      -------------------------------VIAHSQYQNSKRISIFLSM
Q9JJV8_BCL2-01          -------------------------------TTGPTLSPVP---------
B2Z3Z4_BCL2L1-01        -------------------------------ATGHSSSLDAR--------
G3HEA7_BCL2L1-01        -------------------------------ATGHSSSLDAR--------
                                                                          

G3GTB4_BCL2A1-01        -----------------EDGFMKKFE--------------------PKSG
G3HRE9_BCL2L2-01        ------ADPLHQAMRAAGDEFETRFRRTFSDLA-------AQLHVTPGSA
A0A3L7HT14_BCL2A1-      -----------------EDGFMKKFE--------------------PKSG
A0A3L7HT14_BCL2A1-      QDEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTS
A0A3L7HT14_BCL2A1-      QDEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTS
Q9JJV8_BCL2-01          -------PVVHLTLRRAGDDFSRRYRRDFAEMS-------SQLHLTPFTA
B2Z3Z4_BCL2L1-01        --EVIPMAAVKQALREAGDEFELRYRRAFSDLT-------SQLHITPGTA
G3HEA7_BCL2L1-01        --EVIPMAAVKQALREAGDEFELRYRRAFSDLT-------SQLHITPGTA
                                            *  .:                     * :.

G3GTB4_BCL2A1-01        WVTFLETIGQIWE-------------------------------------
G3HRE9_BCL2L2-01        QQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDW
A0A3L7HT14_BCL2A1-      WVTFLETIGQIWE---------------ML--------------------
A0A3L7HT14_BCL2A1-      WNIHQPAEGDAREEALSTGGLDLIFLPGLG--------------------
A0A3L7HT14_BCL2A1-      WNIHQPAEGDAREEALSTGGLDLIFLPGLG--------------------
Q9JJV8_BCL2-01          RGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALW
B2Z3Z4_BCL2L1-01        YQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASW
G3HEA7_BCL2L1-01        YQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASW
                           .  .  :                                        

G3GTB4_BCL2A1-01        --MLFSPQATLLAREDPGSFDN-----------GDHHLVLPFANNSADRT
G3HRE9_BCL2L2-01        MVTYLETRLADWIHSS-GGWAEFTALYGDGALEEARRLR---EGNWASVR
A0A3L7HT14_BCL2A1-      ----FSPQATLLAREDPGSFDN-----------GDHHLVLPFANNSADRT
A0A3L7HT14_BCL2A1-      ----FDKDGNRLGRGK-GYYDTYLKRCVQHQEVKPYTLALAFKEQICPQV
A0A3L7HT14_BCL2A1-      ----FDKDGNRLGRGK-GYYDTYLKRCVQHQEVKPYTLALAFKEQICPQV
Q9JJV8_BCL2-01          MTEYLNRHLHTWIQDN-GGWDAFVELYGPSV-------RPLFDFSWLSLK
B2Z3Z4_BCL2L1-01        MATYLNDHLEPWIQDN-GGWDTFVELYGNNAAAESRKGQERFN------R
G3HEA7_BCL2L1-01        MATYLNDHLEPWIQDN-GGWDTFVELYGNNAAAESRKGQERFN------R
                            :.       . . * :                              

G3GTB4_BCL2A1-01        ----------------------
G3HRE9_BCL2L2-01        TVLTGAVALGALVTVGAFFASK
A0A3L7HT14_BCL2A1-      ----------------------
A0A3L7HT14_BCL2A1-      PVDEHDMKVDEVL-YEDCPAS-
A0A3L7HT14_BCL2A1-      PVDEHDMKVDEVL-YEDCPAS-
Q9JJV8_BCL2-01          TLLSLALVGACIT-LGTYLGHK
B2Z3Z4_BCL2L1-01        WFLTGMTVAGVVL-LGSLFSRK
G3HEA7_BCL2L1-01        WFLTGMTVAGVVL-LGSLFSRK
                                              

© 1998-2020Legal notice