Dataset for protein BCL-2-like of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3L7HT14_BCL2A1-      ----------MITPSLSSHLWLSCLFDWTWQLQSALPRT-----------
A0A3L7HT14_BCL2A1-      ----------MITPSLSSHLWLSCLFDWTWQLQSALPRT-----------
A0A3L7HT14_BCL2A1-      MACA----------------PMLVHRGHAPSLPTASEGDGRGRGGTCHVM
Q9JJV8_BCL2-01          MAQAGRTGYDNREIVMKYIHYKLSQRGYEW-DVGDVDAAPLGAAPTPGIF
B2Z3Z4_BCL2L1-01        MSQS------NRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPE-----
G3HEA7_BCL2L1-01        MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE-----
G3HEA7_BCL2L1-02        MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE-----
                                                  .                       

A0A3L7HT14_BCL2A1-      MTDCEFMYIHSLAEDYLQYVLKVPT----------FESAPSKTSRVLQRV
A0A3L7HT14_BCL2A1-      MTDCEFMYIHSLAEDYLQYVLKVPT----------FESAPSKTSRVLQRV
A0A3L7HT14_BCL2A1-      AAVAASSAKRSLRAELKQRLRALSAEERLRQSHLLTQKVIAHSQYQNSKR
Q9JJV8_BCL2-01          SFQPESNPTPAVHRDMAARTSPLRP----------IVATTGPTLSPVP--
B2Z3Z4_BCL2L1-01        GTESERETPSAINGNPSWHLADSPA----------VNGATGHSSSLDAR-
G3HEA7_BCL2L1-01        GTESERETPSAINGNPSWHLADSPA----------VNGATGHSSSLDAR-
G3HEA7_BCL2L1-02        GTESERETPSAINGNPSWHLADSPA----------VNGATGHSSSLDAR-
                                  ::  :         .             . . :       

A0A3L7HT14_BCL2A1-      ---------ASSVQKEVEKNLKLYLDDFDVR-------------------
A0A3L7HT14_BCL2A1-      ---------ASSVQKEVEKNLKLYLDDFDVR-------------------
A0A3L7HT14_BCL2A1-      ISIFLSMQDEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEI
Q9JJV8_BCL2-01          --------------PVVHLTLRRAGDDFSRRYRRDFAEMS-------SQL
B2Z3Z4_BCL2L1-01        ---------EVIPMAAVKQALREAGDEFELRYRRAFSDLT-------SQL
G3HEA7_BCL2L1-01        ---------EVIPMAAVKQALREAGDEFELRYRRAFSDLT-------SQL
G3HEA7_BCL2L1-02        ---------EVIPMAAVKQALREAGDEFELRYRRAFSDLT-------SQL
                                        :   :.     *  *                   

A0A3L7HT14_BCL2A1-      --SIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGL
A0A3L7HT14_BCL2A1-      --SIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGL
A0A3L7HT14_BCL2A1-      SLLPKTSWNIHQPAEGDAREEA-LSTGGLDLIFLPGLG------------
Q9JJV8_BCL2-01          HLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSP
B2Z3Z4_BCL2L1-01        HITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQV
G3HEA7_BCL2L1-01        HITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQV
G3HEA7_BCL2L1-02        HITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQV
                             *:   .  .  .   :. :. * :  .*  *              

A0A3L7HT14_BCL2A1-      DVGAYKQVSNFVAEFIMNNTAEWIRQNGGWVIAHSQYQNSKRISIFLSMQ
A0A3L7HT14_BCL2A1-      DVGAYKQVSNFVAEFIMNNTAEWIRQNGGW--------------------
A0A3L7HT14_BCL2A1-      ---------------FDKDGNRLGRGKGYY--------------------
Q9JJV8_BCL2-01          LVD---NIALWMTEYLNRHLHTWIQDNGGW--------------------
B2Z3Z4_BCL2L1-01        LVS---RIASWMATYLNDHLEPWIQDNGGW--------------------
G3HEA7_BCL2L1-01        LVS---RIASWMATYLNDHLEPWIQDNGGW--------------------
G3HEA7_BCL2L1-02        LVS---RIASWMATYLNDHLEPWIQDNGGW--------------------
                                       :        . :* :                    

A0A3L7HT14_BCL2A1-      DEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTSW
A0A3L7HT14_BCL2A1-      --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-02        --------------------------------------------------
                                                                          

A0A3L7HT14_BCL2A1-      NIHQPAEGDAREEALSTGGLDLIFLPGLGFDKDGNRLGRGKGYYDTYLK-
A0A3L7HT14_BCL2A1-      ------------------------------EDGFMKKFEPKSGWVTFLET
A0A3L7HT14_BCL2A1-      ------------------------------D--------------TYLK-
Q9JJV8_BCL2-01          ------------------------------D--------------AFVE-
B2Z3Z4_BCL2L1-01        ------------------------------D--------------TFVE-
G3HEA7_BCL2L1-01        ------------------------------D--------------TFVE-
G3HEA7_BCL2L1-02        ------------------------------D--------------TFVE-
                                                      :              :::: 

A0A3L7HT14_BCL2A1-      -------RCVQHQEVKPYTLALAFKEQICPQVPVDEHDMKVDEVLYEDCP
A0A3L7HT14_BCL2A1-      IGQIWEMLFSPQATLLAREDPGSFD----------NGDHHLVLPFANNSA
A0A3L7HT14_BCL2A1-      -------RCVQHQEVKPYTLALAFKEQICPQVPVDEHDMKVDEVLYEDCP
Q9JJV8_BCL2-01          -------LYGPSV-------RPLFDFSWLSLKTLLSLALVGACITLGTYL
B2Z3Z4_BCL2L1-01        -------LYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLF
G3HEA7_BCL2L1-01        -------LYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLF
G3HEA7_BCL2L1-02        -------LYGNNAAAESRKGQERFN------RWFLTGMTVAGVVLLGSLF
                                               *.                         

A0A3L7HT14_BCL2A1-      AS-
A0A3L7HT14_BCL2A1-      DRT
A0A3L7HT14_BCL2A1-      AS-
Q9JJV8_BCL2-01          GHK
B2Z3Z4_BCL2L1-01        SRK
G3HEA7_BCL2L1-01        SRK
G3HEA7_BCL2L1-02        SRK
                           

© 1998-2020Legal notice