Dataset for protein BCL-2-like of organism Cricetulus griseus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3L7HT14_BCL2A1-      ------------MITPSLSSHLWLSCLFDW--------------------
G3HRE9_BCL2L2-01        -MATPASAPDTRALVADFVGYKLRQKGYV---------------------
A0A3L7HT14_BCL2A1-      ------------MITPSLSSHLWLSCLFDW--------------------
A0A3L7HT14_BCL2A1-      MACA----------------PMLVHRGHAPSLPTASEGDGRGRGGTCHVM
Q9JJV8_BCL2-01          MAQAGRTGYDNREIVMKYIHYKLSQRGYEW-DVGDVDAAPLGAAPTPGIF
B2Z3Z4_BCL2L1-01        MSQS------NRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPE-----
G3HEA7_BCL2L1-01        MSQS------NRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPE-----
                                                   .                      

A0A3L7HT14_BCL2A1-      TWQLQSALPRTMTDCEFMYIHSLAEDYLQYVLKVPTFESAPSKTS-----
G3HRE9_BCL2L2-01        -----------------------------------CGAGPGEGPAADP--
A0A3L7HT14_BCL2A1-      TWQLQSALPRTMTDCEFMYIHSLAEDYLQYVLKVPTFESAPSKTS-----
A0A3L7HT14_BCL2A1-      AAVAASSAKRSLRAELKQRLRALSAEERLRQSHLLTQKVIAHSQYQNSKR
Q9JJV8_BCL2-01          SFQPESNPTPAVHRDMAARTSPLRP----------IVATTGPTLSPVP--
B2Z3Z4_BCL2L1-01        GTESERETPSAINGNPSWHLADSPA----------VNGATGHSSSLDAR-
G3HEA7_BCL2L1-01        GTESERETPSAINGNPSWHLADSPA----------VNGATGHSSSLDAR-
                                                                          

A0A3L7HT14_BCL2A1-      --------------RVLQRVASSVQKEVEKNLKLYLDDFD----------
G3HRE9_BCL2L2-01        ----------------LHQAMRAAGDEFETRFRRTFSDLA-------AQL
A0A3L7HT14_BCL2A1-      --------------RVLQRVASSVQKEVEKNLKLYLDDFD----------
A0A3L7HT14_BCL2A1-      ISIFLSMQDEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEI
Q9JJV8_BCL2-01          --------------PVVHLTLRRAGDDFSRRYRRDFAEMS-------SQL
B2Z3Z4_BCL2L1-01        ---------EVIPMAAVKQALREAGDEFELRYRRAFSDLT-------SQL
G3HEA7_BCL2L1-01        ---------EVIPMAAVKQALREAGDEFELRYRRAFSDLT-------SQL
                                        ::         .  . .     :           

A0A3L7HT14_BCL2A1-      VRSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGL
G3HRE9_BCL2L2-01        HVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEP
A0A3L7HT14_BCL2A1-      VRSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGL
A0A3L7HT14_BCL2A1-      SLLPKTSWNIHQPAEGDAREEA-LSTGGLDLIFLPGLG------------
Q9JJV8_BCL2-01          HLTPFTARGRFATVVEELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSP
B2Z3Z4_BCL2L1-01        HITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQV
G3HEA7_BCL2L1-01        HITPGTAYQSFEQVVNELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQV
                             ::   .  .  .    .  . * :  .*  *              

A0A3L7HT14_BCL2A1-      DVGAYKQVSNFVAEFIMNNTAEWIRQNGGWVIAHSQYQNSKRISIFLSMQ
G3HRE9_BCL2L2-01        LVG---QVQDWMVTYLETRLADWIHSSGGW--------------------
A0A3L7HT14_BCL2A1-      DVGAYKQVSNFVAEFIMNNTAEWIRQNGGW--------------------
A0A3L7HT14_BCL2A1-      ---------------FDKDGNRLGRGKGYY--------------------
Q9JJV8_BCL2-01          LVD---NIALWMTEYLNRHLHTWIQDNGGW--------------------
B2Z3Z4_BCL2L1-01        LVS---RIASWMATYLNDHLEPWIQDNGGW--------------------
G3HEA7_BCL2L1-01        LVS---RIASWMATYLNDHLEPWIQDNGGW--------------------
                                       :        . .* :                    

A0A3L7HT14_BCL2A1-      DEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTSW
G3HRE9_BCL2L2-01        --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
A0A3L7HT14_BCL2A1-      --------------------------------------------------
Q9JJV8_BCL2-01          --------------------------------------------------
B2Z3Z4_BCL2L1-01        --------------------------------------------------
G3HEA7_BCL2L1-01        --------------------------------------------------
                                                                          

A0A3L7HT14_BCL2A1-      NIHQPAEGDAREEALSTGGLDLIFLPGLGFDKDGNRLGRGKGYYDTYLK-
G3HRE9_BCL2L2-01        ------------------------------A--------------EFTA-
A0A3L7HT14_BCL2A1-      ------------------------------EDGFMKKFEPKSGWVTFLET
A0A3L7HT14_BCL2A1-      ------------------------------D--------------TYLK-
Q9JJV8_BCL2-01          ------------------------------D--------------AFVE-
B2Z3Z4_BCL2L1-01        ------------------------------D--------------TFVE-
G3HEA7_BCL2L1-01        ------------------------------D--------------TFVE-
                                                                      :   

A0A3L7HT14_BCL2A1-      -------RCVQHQEVKPYTLALAFKEQICPQVPVDEHDMKVD-EVLYEDC
G3HRE9_BCL2L2-01        -------LYGDGALEEARRLR---EGNWASVRTVLTGAVALGALVTVGAF
A0A3L7HT14_BCL2A1-      IGQIWEMLFSPQATLLAREDPGSFD----------NGDHHLV-LPFANNS
A0A3L7HT14_BCL2A1-      -------RCVQHQEVKPYTLALAFKEQICPQVPVDEHDMKVD-EVLYEDC
Q9JJV8_BCL2-01          -------LYGPSV-------RPLFDFSWLSLKTLLSLALVGA-CITLGTY
B2Z3Z4_BCL2L1-01        -------LYGNNAAAESRKGQERFN------RWFLTGMTVAG-VVLLGSL
G3HEA7_BCL2L1-01        -------LYGNNAAAESRKGQERFN------RWFLTGMTVAG-VVLLGSL
                                                .                         

A0A3L7HT14_BCL2A1-      PAS-
G3HRE9_BCL2L2-01        FASK
A0A3L7HT14_BCL2A1-      ADRT
A0A3L7HT14_BCL2A1-      PAS-
Q9JJV8_BCL2-01          LGHK
B2Z3Z4_BCL2L1-01        FSRK
G3HEA7_BCL2L1-01        FSRK
                            

© 1998-2021Legal notice