Dataset for protein BCL-2-like of organism Cricetulus griseus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A3L7HT14_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2A1 (length=333 residues).
MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQYVLKVPTFESAPSKTSRVLQRVASSVQKEVEKN
LKLYLDDFDVRSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQVSNFVAEFIMNNTA
EWIRQNGGWVIAHSQYQNSKRISIFLSMQDEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTSWN
IHQPAEGDAREEALSTGGLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTLALAFKEQICPQVPVDEHDM
KVDEVLYEDCPAS
>gnl|bcl2dbpro|A0A3L7HT14_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2A1 (length=236 residues).
MACAPMLVHRGHAPSLPTASEGDGRGRGGTCHVMAAVAASSAKRSLRAELKQRLRALSAEERLRQSHLLTQKVIAHSQYQ
NSKRISIFLSMQDEIETEEIIKDIFKQGKICFIPRYRFQSNHMDMVRLASPEEISLLPKTSWNIHQPAEGDAREEALSTG
GLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTLALAFKEQICPQVPVDEHDMKVDEVLYEDCPAS
>gnl|bcl2dbpro|A0A3L7HT14_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2A1 (length=232 residues).
MITPSLSSHLWLSCLFDWTWQLQSALPRTMTDCEFMYIHSLAEDYLQYVLKVPTFESAPSKTSRVLQRVASSVQKEVEKN
LKLYLDDFDVRSIDTARTIFNQVMEKEFEDGIINWGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQVSNFVAEFIMNNTA
EWIRQNGGWEDGFMKKFEPKSGWVTFLETIGQIWEMLFSPQATLLAREDPGSFDNGDHHLVLPFANNSADRT
>gnl|bcl2dbpro|B2Z3Z4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G3HEA7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G3HEA7_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|Q9JJV8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cricetulus griseus GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTG
PTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGTYLGHK
© 1998-2020Legal notice