Dataset for protein BCL-2-like of organism Cricetulus griseus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C2LQI3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2A1 (length=169 residues).
MTDCEFMYIHSLAEDYLQYVLKVPTFESAPSKTSRVLQRVASSVQKEVEKNLKLYLDDFDVRSIDTARTIFNQVMEKEFE
DGIINWGRIVTVFAFGGVLLKKLAQEQIGLDVGAYKQVSNFVAEFIMNNTAEWIRQNGGWEDGFMKKFEPKSGWVTFLET
IGQIWEMLF
>gnl|bcl2dbpro|A0A8C2MG79_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cricetulus griseus GN=MCL-1 (length=340 residues).
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLTAEEAKARREGGGEAGLLPGARVAVRPPPVGAEDPDVTASAERRLLR
SPGLLAVPPEEMAAPASASSSTAAAAAIMSPEEELDGCEPEALGKRPAVLPLLERVSSEAAKNPGAAGSLPSTPPSAEEE
EDELYRQSLEIISRYLREQAAGVKDAKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKMDIKNEDDVKSFSRVM
VHVFKDGITNWGRIVTLISFGAYVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRN
VLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C2MG79_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Cricetulus griseus GN=MCL-1 (length=292 residues).
MFGLRRNAVIGLNLYCGGDPDVTASAERRLLRSPGLLAVPPEEMAAPASASSSTAAAAAIMSPEEELDGCEPEALGKRPA
VLPLLERVSSEAAKNPGAAGSLPSTPPSAEEEEDELYRQSLEIISRYLREQAAGVKDAKPLGEAGAAGRRALETLRRVGD
GVQRNHETAFQGMLRKMDIKNEDDVKSFSRVMVHVFKDGITNWGRIVTLISFGAYVAKHLKSINQESCIEPLAESITDVL
VRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C2MSB6_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L10 (length=174 residues).
MDDPLLERTRRLLTDYLMFCAREPDEPEPLPRSVEAALLRSVAEQFQEQHHFFFSSFYGYKGNRVLLMTQMADAVLSDSE
GFNWGRLVMLLAFAGTIVSQEQINVLLDCQLIVDLLCDRILGQHRSWLEAHGGWDGFYHFFSSHLPLDFWRSLLIKTFLY
WVFATAMLFIWKRL
>gnl|bcl2dbpro|B2Z3Z4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G3HEA7_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|G3HRE9_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Cricetulus griseus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|Q9JJV8_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Cricetulus griseus GN=BCL-2 (length=236 residues).
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPAVHRDMAARTSPLRPIVATTG
PTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVN
REMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVRPLFDFSWLSLKTLLSLALVGACITLGTYLGHK
© 1998-2022Legal notice