Dataset for protein BCL-2-like of organism Coregonus sp balchen

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ::..   .   *            :  :    . . *            . ...:  .  :   .  . .:*   
----msysnrelvvyyItyklsqrnypfnqlgltgassrteG----------gevianasvgtnvngtsnlgspstPp--
mnlmktfnratttmff s------d---chtvveevqgypa asplyyfgeneqaegggaptnyrdtrvggtkggs qrr
   s       eln - r    - sc-  v sp q           agdp d s  lmskp sdm t d  lpp
                                 g                 a c     k  c l           
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      *:.. .    
----------------------------s-p--p-----------------------------------gGleavk----
tklavnvvksnvldnhlsdrsnnddsdq-p-st-qrtsecgpdisncpsgdevlehdtrqlienvlgdyt idpsrwkqs
                           d l cs rma                                m        
                                                                     e          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    ::.  .::.  .:  *:..: .:* :   :     ::.* . :* **: ****:..*.***..:.    :.  .  
---ealrdsanefelrytrAfsdlssqLhitp-atayqsfesVmdevFrDGv-NWGRvvgLfAFGgalcvecvekemspl
ktlatmkrvvddviakhay yngmadk dlddrsddmhvikn aktl s  it    ias v   avvsqhlkdrdrghc
   t                i            s                               i        
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*  : : ::.** .  . *: .:..*                                                      
VgriadwmttYLdnhiqpWiqsqggW----------------------------d---eifgrdaaadvrrsqesf-kwl
 tlvtqeiav  lsdqrd lvknna vshdfslgsaergvvlflvggcvmgwke-tfa------------------r---
  ge                    mkaa       n f e f           rvk  hvq pesss ntliavkg  
                                                     c      k    e  k    li   
                                                                            a   

       330       340 
....:....|....:....|.
                     
lvgv-l-sgvlvg-li--kr-
-a--t-v------t--mk--q
v- mmattamvirs  aq  l
   ii ll             
    g f              
© 1998-2020Legal notice