Dataset for protein BCL-2-like of organism Coregonus sp balchen

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6F8ZUL6_BCL2L1-      ----MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEG--------
A0A6F9CY91_BCL2L1-      ----MSYSNRELVVFFISYRLSQRNYSFCQLGLEGVSGRTEG--------
A0A6F9BJ02_BCL2L1-      ---MMTYNNRELVEYYITYKLSQRDYPFNHIGLTESQSRTEG--------
A0A6F9B188_BCL2L1-      ---MMTYNNRELVVYYITYKLSQRDYPFNHTGLTEAPSQTEG-------G
A0A6F9BEN5_MCL1-02      MNLSKSFTRATTTMLNI------------QNGVVGGSSYPAGASPLYYFG
                             ::..   .   *            :  :    . . *        

A0A6F8ZUL6_BCL2L1-      --EEAIANGSLGNNRNGRSNLGKPSSPQ----------------------
A0A6F9CY91_BCL2L1-      --DEAIANGSVGNNRNSRSNLGKPSSPL----------------------
A0A6F9BJ02_BCL2L1-      --GPVDGSAAVMTYVNCTMNGTSPGTPPPR--------------------
A0A6F9B188_BCL2L1-      EGGQVEGGAAVTTHPNGTVNGTSPGTPPR---------------------
A0A6F9BEN5_MCL1-02      ANGAVCAGASPKSKVDTDLGNGTGDTPPRPTKLAVNVVKSNVLDNHLSDR
                            . ...:  .  :   .  . .:*                       

A0A6F8ZUL6_BCL2L1-      -------------------------------------------------G
A0A6F9CY91_BCL2L1-      -------------------------------------------------G
A0A6F9BJ02_BCL2L1-      -------QSPPSSPRRT--------------------------------E
A0A6F9B188_BCL2L1-      -------QSPPSTPQRT--------------------------------M
A0A6F9BEN5_MCL1-02      SNNDDSDDSLPCTPQMASECGPDISNCPSGDEVLEHDTRQLIENVLGDYT
                                                                          

A0A6F8ZUL6_BCL2L1-      GIEAVK-------AALRDSVDEFELRYTRAFSDLSSQLHITP-ATAYHSF
A0A6F9CY91_BCL2L1-      GIEAVK-------AALRDSADEFELRYTRAFSDLASQLHITP-ATAYHSF
A0A6F9BJ02_BCL2L1-      GLDAVK-------EALRDSANEFELRYARAFSDLASQLHITP-STAYQSF
A0A6F9B188_BCL2L1-      GLDAVK-------EALRDSANEFELRYARAFSDLSSQLHITP-ATAYQSF
A0A6F9BEN5_MCL1-02      GLSPSRWKQSKTLTTMKRVVEDVIAKHRYAYNGMIDKLDLDDRSDDMSVI
                        *:.. .        ::.  .::.  .:  *:..: .:* :   :     :

A0A6F8ZUL6_BCL2L1-      ESVMDEVFRDGV-NWGRVVGLFAFGGALCIECVEKDMSHLVTRIADWMAT
A0A6F9CY91_BCL2L1-      ESVMDEVFRDGV-NWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTT
A0A6F9BJ02_BCL2L1-      ENVMDEVFRDGV-NWGRVVGLFAFGGALCVECVDKEMSPLVGRITDWMTV
A0A6F9B188_BCL2L1-      ENVMDEVFRDGV-NWGRVVGLFAFGGALCVECVEKEMSPLVGRIAEWMTV
A0A6F9BEN5_MCL1-02      KSVAKTLFSDGITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIAT
                        :.* . :* **: ****:..*.***..:.    :.  .  *  : : ::.

A0A6F8ZUL6_BCL2L1-      YLDNHIQPWIQSQGGW----------------------------DCFAEI
A0A6F9CY91_BCL2L1-      YLDNHIQPWIQSQGGW----------------------------DRFAEI
A0A6F9BJ02_BCL2L1-      YLDNHIQPWIQSQGGWVSHD------------------------------
A0A6F9B188_BCL2L1-      YLDNHIQPWIQSQGGWMKAAFSLGSAERGVVLFLVGGCVMGWKEDTVKEI
A0A6F9BEN5_MCL1-02      YLLSDQRDWLVKNNAW-----------NGFVEFF----------------
                        ** .  . *: .:..*                                  

A0A6F8ZUL6_BCL2L1-      FGRDAAADVRRSQESLRKWLLVGVMLLSGVLVGTLIMKKRQ
A0A6F9CY91_BCL2L1-      FGRDAAADVRRSQESVIKWLLVGVILFSGVLVGTLIMKKRQ
A0A6F9BJ02_BCL2L1-      -----------------------------------------
A0A6F9B188_BCL2L1-      FGKDAAAESRKSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A6F9BEN5_MCL1-02      HVQDPESSVRNTLIAFAG--VAGIGATLAMLIR--------
                                                                 

© 1998-2020Legal notice