Dataset for protein BCL-2-like of organism Coregonus sp balchen

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A6F8ZUL6_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGEEAIANGSLGNNRNGRSNLGKPSSPQGGIEAVKAALRDSVDE
FELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCIECVEKDMSHLVTRIADWMATYLDN
HIQPWIQSQGGWDCFAEIFGRDAAADVRRSQESLRKWLLVGVMLLSGVLVGTLIMKKRQ
>gnl|bcl2dbpro|A0A6F9B188_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BCL2L1 (length=262 residues).
MMTYNNRELVVYYITYKLSQRDYPFNHTGLTEAPSQTEGGEGGQVEGGAAVTTHPNGTVNGTSPGTPPRQSPPSTPQRTM
GLDAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSP
LVGRIAEWMTVYLDNHIQPWIQSQGGWMKAAFSLGSAERGVVLFLVGGCVMGWKEDTVKEIFGKDAAAESRKSQESFKKW
LLAGMTLVTGVVVGSLIAQKRL
>gnl|bcl2dbpro|A0A6F9BEN5_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=MCL-1 (length=292 residues).
MNLSKSFTRATTTMLNIQNGVVGGSSYPAGASPLYYFGANGAVCAGASPKSKVDTDLGNGTGDTPPRPTKLAVNVVKSNV
LDNHLSDRSNNDDSDDSLPCTPQMASECGPDISNCPSGDEVLEHDTRQLIENVLGDYTGLSPSRWKQSKTLTTMKRVVED
VIAKHRYAYNGMIDKLDLDDRSDDMSVIKSVAKTLFSDGITNWGRIASLVAFGAVVSQHLKERGRGHCVELVGQEIATYL
LSDQRDWLVKNNAWNGFVEFFHVQDPESSVRNTLIAFAGVAGIGATLAMLIR
>gnl|bcl2dbpro|A0A6F9BJ02_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BCL2L1 (length=189 residues).
MMTYNNRELVEYYITYKLSQRDYPFNHIGLTESQSRTEGGPVDGSAAVMTYVNCTMNGTSPGTPPPRQSPPSSPRRTEGL
DAVKEALRDSANEFELRYARAFSDLASQLHITPSTAYQSFENVMDEVFRDGVNWGRVVGLFAFGGALCVECVDKEMSPLV
GRITDWMTVYLDNHIQPWIQSQGGWVSHD
>gnl|bcl2dbpro|A0A6F9CY91_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Coregonus sp. 'balchen' GN=BCL2L1 (length=219 residues).
MSYSNRELVVFFISYRLSQRNYSFCQLGLEGVSGRTEGDEAIANGSVGNNRNSRSNLGKPSSPLGGIEAVKAALRDSADE
FELRYTRAFSDLASQLHITPATAYHSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDN
HIQPWIQSQGGWDRFAEIFGRDAAADVRRSQESVIKWLLVGVILFSGVLVGTLIMKKRQ
© 1998-2020Legal notice