Dataset for protein Bcl-w of organism Chinchilla lanigera

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************************.            .*.
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWp------------sAr
                                                                aeftalygdgalee k

       170       180       190    
....:....|....:....|....:....|....
 :  *:             :***:      * * 
rlsrGn-------------mGALvtvwdsfAsK-
lire kwasvrtvltgaval   igsgafc r e
© 1998-2022Legal notice