Dataset for protein Bcl-w of organism Chinchilla lanigera

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2VJ88_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A8C2VJ88_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                        **************************************************

A0A8C2VJ88_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A8C2VJ88_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                        **************************************************

A0A8C2VJ88_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWP-----
A0A8C2VJ88_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTAL
                        ********************************************.     

A0A8C2VJ88_BCL2L2-      -------SAKLISRGK-------------MGALIGSWDSCARKE
A0A8C2VJ88_BCL2L2-      YGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK-
                               .*. :  *:             :***:      * * 

© 1998-2022Legal notice