Dataset for protein Bcl-w of organism Chinchilla lanigera

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C2VJ88_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L2 (length=169 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWPSAKLISRGKMGALIG
SWDSCARKE
>gnl|bcl2dbpro|A0A8C2VJ88_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Chinchilla lanigera GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
© 1998-2022Legal notice